KEGG   Mus musculus (mouse): 76459
Entry
76459             CDS       T01002                                 

Gene name
Car12, 2310047E01Rik, AI314958, CA-XII, Ca12
Definition
(RefSeq) carbonic anhydrase 12
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00910  Nitrogen metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    76459 (Car12)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     76459 (Car12)
SSDB
Motif
Pfam: Carb_anhydrase YabP
Other DBs
NCBI-GeneID: 76459
NCBI-ProteinID: NP_848483
MGI: 1923709
Ensembl: ENSMUSG00000032373
Vega: OTTMUSG00000025353
UniProt: Q8CI85 A0A0R4J0W4
Position
9; 9 C
AA seq 354 aa
MPHRSLRATVVLLLVILKKQPSSSAPLNGSKWTYVGPAGEKNWSKKYPSCGGLLQSPIDL
HSDILQYDASLAPLQFQGYNVSVEKLLNLTNDGHSVRLNLNSDMYIQGLQPHHYRAEQLH
LHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDLYPDFSTASDKSEGLAVLAVLIEIGSA
NPSYDKIFSHLQHVKYKGQQVLIPGFNIEELLPESPGEYYRYEGSLTTPPCYPTVLWTVF
RNPVQISQEQLLALETALYFTHMDDPTPREMINNFRQVQKFDERLVYISFRQGLLTNTGL
SLGIILSVALAGVLGISIVLAVSIWLFKRKKSKKGDNKGVIYKPAIKKEAEVHA
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgcctcaccgcagcctgcgcgcgactgtcgtcctcctgttggtgatccttaagaagcag
ccttccagctcagccccactcaacggatccaagtggacctatgttggtcctgctggggaa
aagaactggtccaagaagtacccatcgtgtggaggcctcctgcagtccccgatagaccta
catagcgacatccttcagtatgatgctagcctcgcacccctccagttccaaggttacaat
gtgtctgttgaaaagctgttgaacctgaccaatgatggccattcagtgagactgaatctg
aactcagacatgtacatccagggtctccagcctcaccactacagagcagagcagctgcac
ttgcactgggggaaccgcaatgacccccatggctctgaacacaccgtgagtgggaagcac
tttgctgccgagctgcacattgtccattataactcagacctgtaccctgacttcagcacc
gccagtgacaagtccgaaggcctcgctgtccttgctgttcttattgagataggctccgcc
aatccatcatatgacaagatcttcagccatcttcaacatgttaagtataaaggccaacaa
gtgctcatcccaggcttcaacattgaagaacttctgcccgagagccctggcgagtattac
cgctatgaagggtccctgactacacctccttgctaccctaccgtgctctggacagttttc
cgaaaccctgtgcagatttcccaggagcagctgctggctttggagacagctctgtacttc
acacacatggatgatcctacccccagagaaatgatcaacaacttccggcaggtccagaag
ttcgatgagaggctggtgtatatctccttccgacaaggactgcttaccaacacaggactg
agtttgggtatcatcctttcagtggccctggctggcgttcttggcatctccattgttctg
gcagtgtctatttggctcttcaaaaggaagaagagcaaaaaaggtgacaacaagggagtc
atttataaaccagccatcaagaaggaggctgaggtccacgcctga

DBGET integrated database retrieval system