KEGG   Mus musculus (mouse): 76464Help
Entry
76464             CDS       T01002                                 

Gene name
Knl1, 2310043D08Rik, 5730505K17Rik, Casc5
Definition
(RefSeq) kinetochore scaffold 1
  KO
K11542  protein CASC5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    76464 (Knl1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    76464 (Knl1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     76464 (Knl1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     76464 (Knl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 76464
NCBI-ProteinID: NP_001349661
MGI: 1923714
Ensembl: ENSMUSG00000027326
Vega: OTTMUSG00000015766
Position
2; 2 E5
AA seq 1612 aa AA seqDB search
MDGVYSEANEENDNTQRPVRRQHSSILKPPRSPLQDLKCGNQTNQEPNPPRKRKSSRRVS
FADTIKVFQTESHMKTERNSEISGMNTLLCAPIQTQMQQKEFSITDCNHERKHANDQTVI
FSDENQMDLTASHTVMITKGLSDCTKNENSTKIDTTSFLENLKHHAANSRIKKDLACSTV
SLSQNIFSEKINSDNFIKRLKTGKHISSSTELDKENAEIPVYSKDSNSASSTYQMHASLG
VDENSSNRTRIFREQDDGMNLTQCHTACIKTWIPPSTEAKIGEFKGDKTIYGNECMELTT
NYTIQVLSSENNLSERETQTQNGMNVTTVDGATAPAPEKKTALKDKLNAAFQGSFPNPEN
KIHIIKCHPIESETHTVTQISSQSASTLAVTSKSICSSPAIEGYKTIFHSSSNDAMELTK
CLSAMEEEKKLLKADDKYSKICTNPDAGPLREKTIYLEEDSMDITKSHTVAIDNKIFKHD
QENIKKEIIAIPIFEKEMVLRNLMPMSKDEKRDVNYISVPQVSKESLQRSQTNTLSVSLT
DKKMEFLADEDMDLTKSHTTKLSQVIPTTFDLASKNVTKSYSHSKSPLNEWESLDKQVVL
GQHSKLPLPQRKDRDDPDCSHHKIMYSEELQTMDLTKSHTIVIGFGPSEVQEHSKINLEH
KNSQLTAESIQTAVNVPAANSRVVTTNDMDMLKDRSTHKPELLKEKQNIKIYGRKSIGRL
KIDKTILFSEGNEGDMDITKSCTVKINHRSLLDKHDSHLVSLAGTSKTILHARGQVEMEI
NRSHTTPLECKIISPSDITPGDLDKTMMSIDDHEELDMTKSHTVFIDYQAEAKGVLPDRL
DFQLSKKESLQKPKVTSLAEEIYISKNSESNHLPAKGSQLTILEEGSNSGLGEETNDAQK
PGFLNELLSGKTQRRKSLSLKNKSITFPENDKSYREIPQSSAVEINNETRLEDRKGFSFV
PLAGTSKPVLSAYGPEDMEISIGQTTASEYKTVPPEEITTIPMDKTVMFVDNFGDLDVTR
SHTVFIDCQAKEKVLDEYTNLGIQKTKTLSGSEGDTHIQEITKNPAAQHKHHMTTVIPSS
TVVSDQSSMKIKFHKADRDEEVKGKEVEANMLKQTKPESCLLNITDGKNVDFTSSYTADV
CRSSDKYSSLPNISSSDNSGGNTMSLCDKNKEKAYNCQVPNEFTYAAILPSTYHMDSKKL
SVFPPCPSKEVTQTESAIALLKDEDPVEEPLGEMATFNSKHVSLNLAKDQTEAFVDVSVA
SQPHLSAQQSPSTQKGQDVARRDEGILAKAGKKALPFLLENVAASTWENESKIPTNVEHF
AVTYEKELSISIQTDKCNTNVQSPSNSALTTQVIQTHANAEGALDFLVPSTVSCFSSTKP
SLSNLNRKTEEVLDFQTVNLLPPAEQLLEEGSQAHSMSIVQATEIYRLGSRNDRDEESKT
FCNEAETTSVPLKTAVKDKTRRCSLGIFLPKLPSKRSCSITGVDDLEQILADAADLTQLE
TQPVCSKDPGIGSVAAKLNLSPSQFINEENLPVYPGEILSSDSVSLDIEESVLIDTSQRE
SLPSENKTENCRAQKRTRVEENDVTNEKKIRTHDSAQDQEVSCLEPKNVLEF
NT seq 4839 nt NT seq  +upstreamnt  +downstreamnt
atggatggggtatattcagaagctaatgaagagaatgacaatacacagagacctgttaga
agacagcattcctcaattttgaaacccccaaggagtcctcttcaggacctcaaatgtgga
aatcaaacaaaccaggaacctaatcctccaagaaaaaggaaaagctctcgtcgagtcagc
tttgcagatactataaaagtattccagacagagtctcacatgaaaacagagagaaattca
gaaatttcaggtatgaacactttgctttgtgctccaattcagactcagatgcaacaaaag
gagttctcaattacagactgcaaccatgaaaggaaacatgcaaatgatcagacagtcatc
ttttcagatgaaaaccagatggatctgacagcaagtcacactgtaatgattaccaaaggt
ctttcagactgtaccaaaaatgaaaattctacaaaaatagataccacgtcctttctggag
aatttaaagcatcatgctgcaaattcaagaattaaaaaggatttagcatgttccacagtt
tccttaagtcaaaacattttctcagaaaagatcaattctgacaacttcataaaaagattg
aagacaggaaaacatatttcgtcttctacagagcttgataaggaaaatgctgagatacct
gtttattccaaagactcaaacagtgcctcttcaacatatcaaatgcatgcatctcttggt
gtagatgaaaatagtagtaataggactagaatctttagagaacaagatgatggtatgaat
ttgacccaatgtcatacagcctgtattaagacttggattcctccatccacggaggccaaa
ataggagaattcaaaggtgataaaacaatttatggcaatgagtgtatggagttgacaact
aactatacgatacaggttttgtcatcagaaaataatttatctgaaagagaaactcaaact
caaaatggtatgaatgttacaacagttgatggagctacagctccagctccagagaagaaa
acagcccttaaggataaactaaatgctgcttttcaaggctctttcccaaaccctgaaaat
aaaattcatattatcaaatgtcatcctatagagtcagaaactcatacagtcacacagatt
tctagtcaaagtgccagcacattggctgtaacttcaaaatctatatgttctagtccagct
attgaggggtataagacaatttttcattctagtagcaatgatgcaatggaactgactaag
tgtctatcagctatggaagaggaaaaaaaattgctgaaggctgatgataagtattctaaa
atatgtaccaatccagatgctggcccactcagagagaaaactatttatttagaagaggat
agcatggacattaccaaaagtcacaccgttgcaatagataataaaatatttaaacatgat
caagaaaacattaaaaaagaaataatagccataccaatatttgaaaaggaaatggtgctc
cgaaatcttatgcctatgtcaaaagatgagaaaagggatgtaaattatatttcagttcct
caagtatctaaggaaagcttacaacggagtcagacaaacactttatctgtttcattgact
gacaaaaagatggaattcttggcagatgaagatatggatctgactaaaagtcacacaact
aagttaagtcaagttattcctacaacttttgacttagcatcaaagaatgtcaccaaatca
tactctcacagcaaaagccctttaaatgagtgggaaagcctggataaacaagtagtgcta
ggccagcattctaaacttcctttaccacagaggaaagatagagatgatcctgactgttct
catcataagataatgtattcagaggagttacaaactatggatctaaccaagagccacact
attgtaattggctttggtccttctgaagtacaagaacatagtaaaattaatttagaacac
aaaaacagccaacttacagcagaaagcatacaaacagctgtgaacgttcctgcagcaaac
tctagagtagtaacaactaatgatatggacatgttaaaggacagaagtacacataagcca
gaattgctgaaggaaaagcaaaacatcaaaatctatggaagaaaaagtattggtagactg
aaaattgataaaactatattattttcagagggtaatgagggtgatatggatatcaccaag
agttgcacagtcaaaataaatcatagatctttattagataagcatgattctcatttagta
tctttggcaggaacttctaaaaccattttgcatgcacgtggtcaggttgaaatggaaatc
aatagaagtcacacaactcctttagaatgtaaaattatctcgcccagtgatataactcct
ggtgatctggataagactatgatgtctatagatgatcatgaggaactagacatgaccaag
tcccatactgttttcattgactaccaagcagaggcaaaaggtgtacttccagacagactt
gactttcaattatccaaaaaggaaagcctacagaagccgaaagtgacatctctggctgaa
gagatttacatttcaaaaaatagtgaaagcaaccatctaccagcaaaaggcagccagcta
acaatattagaggaagggtctaatagcgggcttggagaggaaactaatgatgcacaaaag
cctggatttctgaatgaacttctgtcaggcaaaactcagagaagaaaaagccttagcctc
aaaaacaagagtattacatttccagagaatgataaaagttatagagagatccctcagagt
tctgcagtagaaataaataatgaaactaggctggaagacagaaagggcttcagttttgtg
ccattggcaggaacttccaaaccagttttgtctgcatatgggcccgaggacatggagatt
tctataggtcaaaccactgcttcagaatataaaactgtcccaccagaagaaataactact
atacctatggataaaactgtaatgtttgtagataatttcggtgatctggatgtcaccaga
tcccatacggttttcatcgattgtcaagccaaagaaaaggtacttgatgaatatactaac
ttgggaatacagaaaacaaaaactttgagtggttctgaaggtgatacccatattcaagaa
atcacaaaaaacccagcagctcaacacaaacaccatatgacaactgttattccttctagt
acagtagttagtgatcaaagttcaatgaaaatcaagtttcacaaagctgatagagatgag
gaggtcaaaggaaaggaagtggaagccaatatgctgaaacaaactaaacctgaaagctgt
ctgttaaatataacagatggaaaaaatgtggattttacaagcagttatacagctgatgtt
tgtagatccagtgacaagtattcctctttaccaaatatttcttcttctgataattcgggt
ggtaatactatgtccttgtgtgataaaaataaggagaaagcttataattgccaagtgcca
aatgaatttacttatgcagctatcttaccaagtacatatcacatggattctaaaaaactg
tctgtctttccaccttgtccttcaaaagaagtcactcaaactgaaagtgccatagcgctg
cttaaagatgaagatccggtagaagagcctctgggggagatggctacatttaactcaaag
catgtatctcttaacctggcaaaggatcaaacagaggcctttgttgatgttagtgttgct
tctcagcctcatctctcagcccaacaaagtccatcaactcaaaaagggcaggatgttgcc
cgtagagatgaaggaatattagctaaagctgggaagaaggctttaccttttcttctagaa
aatgtcgctgcatccacatgggaaaatgagtccaaaatacccactaatgtggaacacttt
gctgtaacctatgaaaaagaactgagtataagtattcaaacagataaatgtaatacaaat
gtacagagccctagtaactcggccctgacaacacaagtcattcagacgcatgcaaatgct
gaaggagcactagactttttagttccatctactgtttcatgttttagtagtaccaaacca
agtctgagtaatttgaatagaaaaactgaggaggtcttagactttcagactgttaattta
ttacctcctgccgaacagttacttgaagaaggaagtcaggcacatagtatgagtatagta
caagctacagaaatatatagactaggttccaggaatgatagagatgaagaaagtaaaact
ttctgtaatgaggctgaaactacatctgtaccactaaaaacagctgttaaagacaaaaca
agaagatgttcattggggatatttttacccaaattaccaagcaagagaagttgtagtatc
actggtgttgatgacctggaacagattctagcagatgcagctgacttaactcaactagaa
actcagccagtctgtagtaaagatccaggcattggatctgttgcagccaaactgaatttg
agtccatctcagtttataaatgaggaaaatctccctgtatatcctggtgagatactttca
tcagattctgttagcctggacattgaggaaagtgttctgattgacacatctcagagagag
agtttaccgtctgaaaacaaaaccgaaaactgcagggcccaaaaaagaacccgggttgaa
gaaaatgatgttacaaatgagaaaaaaatcagaacacatgacagtgcacaagatcaagag
gtaagctgtcttgagccaaaaaatgttcttgaattttaa

DBGET integrated database retrieval system