KEGG   Mus musculus (house mouse): 76482
Entry
76482             CDS       T01002                                 
Symbol
Rmc1, 2400010D15Rik, 3110002H16Rik, Mic-1, Mic1, Wdr98
Name
(RefSeq) regulator of MON1-CCZ1
  KO
K24763  regulator of MON1-CCZ1 complex
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    76482 (Rmc1)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Others
   Others
    76482 (Rmc1)
SSDB
Motif
Pfam: Mic1
Other DBs
NCBI-GeneID: 76482
NCBI-ProteinID: NP_083899
MGI: 1916528
Ensembl: ENSMUSG00000024410
UniProt: Q8VC42 Q3TWH4 Q3UMX3 Q3U4H5
Position
18:12301746..12331732
AA seq 657 aa
MGGEDYYLELCERPVQFEKANPVNCVFFDEANKQVFAVRSGGATGVVVKGPDDRNPISFR
MDDRGEVKCIKFSLENKILAVQRTAKAVDFCNFIPDNSQLEYTQECKTKNANILGFCWTS
STEIVFITDQGIEFYQVMPEKRSLKLLKSHNINVNWYTYCPESAVILLSTTVLENVLQPF
HFRAGTMSKLPKFEIELPAAPKSTKLSLSERDIAMATIYGQLYILFLRHHSRTSNSTGAE
VVLYHLPREGACKKMHILKLNRTGKFALNVVDNLVVVHHQDTETSVIFDIRLRGEFDGTV
TFHHPVLPARSIQPYEIPLAGPAAVTSQSPVPCKLYSSSWIVFQPDIIISASQGYLWNLQ
VKLQPIVNLLPDKGRLMDFLLQRKECKAVVLSVCSQMLSESDRATLPVIATVFDKLNHEY
KKYLDADQSYTMAVEAGQSRSNPPLKRPVRTQAVVDQSDVYTQVLSPFVENKEMPHKFVI
AVLMEYIRSLNQFQIPVQHYLHELVIKTLVQHNLFYMLHQFLQYHVLSDSKPLACLLLSL
ESFYPPAHQLSLDMLKRLSTANDEIVEVLLSKHQVLAALRFIRGIGGHDNISARKFLDAA
RQTDDVMLFYTIFRFFEQRNQRLRGNPNFTPGEHCEEHVAFFKQVFGEQALMRPTTF
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgggcggcgaggactactacctggagctgtgcgagcggccggtgcagttcgagaaggcg
aacccggttaactgcgtgttcttcgatgaggccaacaagcaggtttttgctgttcggtcg
ggtggagctacaggagtggtcgttaaaggcccagatgataggaatcccatctcttttagg
atggacgacagaggagaggtgaagtgcatcaagttttctttagaaaacaagatcctggct
gtgcagaggactgcgaaggctgtggacttttgtaattttattccagataactctcaactg
gagtacacacaagagtgcaagaccaagaatgccaacatactcggattctgctggaccagc
tctactgagatcgtcttcataactgaccaaggcatcgaattttaccaggtgatgcctgag
aaacgaagtctcaaactcctgaagagtcacaacatcaatgtgaactggtacacgtattgc
cccgagagcgccgtgatcctgctgtccaccacagtccttgagaatgtcctgcagcctttc
cattttagggctggcaccatgtcgaagcttcccaagttcgagattgagttaccagctgca
ccgaagtcaactaaacttagcctttcagaacgagacattgcgatggcgaccatatacggg
cagctttacatcctcttcctgcgccatcactctcggacgtctaacagcacgggagcggag
gtggtgctgtaccatctcccacgagagggtgcatgtaaaaagatgcacatactgaagtta
aataggacgggaaagtttgccctaaatgtagtggacaacctggtcgttgtccaccatcag
gacacagagacgtcagtgatatttgacatcaggctacggggcgagttcgatggcacggtt
accttccaccatcctgtgcttccagcccgatcaattcaaccttacgagatccccctggca
ggtcctgcagccgtgaccagccagtctcctgtcccctgtaaactctattcctcttcatgg
atcgtctttcaaccagacatcattatcagtgcaagccaaggttacctctggaacctgcag
gtgaaacttcagcccatagtgaatctcttgccagataaaggaaggctgatggactttctc
ctccagaggaaggagtgcaaggcggtggttctgtctgtgtgttcacagatgctgagtgag
tcagacagagccacgctgcctgtgatagccaccgtgtttgataaactcaaccatgagtat
aagaagtacttggatgctgatcagagctacacaatggcagtagaagcagggcagagccgg
agcaacccacctctcaaaaggccagtgcgaacccaagcagtggtagaccagtctgatgtg
tacacacaggtgctgtcaccattcgtggaaaacaaggagatgccgcacaagtttgtgata
gctgtgctgatggaatatattcgttctctgaaccagtttcagattccagtgcagcactac
ttacatgaacttgtcatcaagacactggtccagcataacctcttctacatgctgcaccag
ttcctgcagtaccacgtgctcagcgactccaagcctttggcttgcttgctgctgtcccta
gagagcttttatcctcccgcccaccagctatctctggacatgttgaagagactttcaaca
gcaaatgatgagatagtagaagttcttctgtctaaacaccaggtgttggctgccctgagg
ttcatccggggcattggtggccatgacaacatttctgctcgcaaattcttagatgctgcg
aggcagaccgacgatgtcatgctcttctataccatattccgcttctttgaacagcggaac
cagcgcctgcgagggaaccctaacttcacaccaggagagcactgtgaagaacacgttgcc
tttttcaagcaggtttttggagaacaagctctaatgaggcctacaacattctga

DBGET integrated database retrieval system