KEGG   Mus musculus (mouse): 76491Help
Entry
76491             CDS       T01002                                 

Gene name
Abhd14b, 1810013B01Rik
Definition
(RefSeq) abhydrolase domain containing 14b
  KO
K13706  abhydrolase domain-containing protein 14
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    76491 (Abhd14b)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S33
   76491 (Abhd14b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 76491
NCBI-ProteinID: NP_083907
MGI: 1923741
Ensembl: ENSMUSG00000042073
Vega: OTTMUSG00000049534
UniProt: E9QN99
Position
9; 9 F1
AA seq 210 aa AA seqDB search
MAGVDQHEGTIKVQGQNLFFRETRPGSGQPVRFSVLLLHGIRFSSETWQNLGTLQRLAEA
GYRAVAIDLPGLGRSKEAAAPAPIGEPAPGSFLAAVVDTLELGPPVVISPSLSGMYSLPF
LVAPGSQLRGFVPVAPICTDKINAVDYASVKTPALIVYGDQDPMGSSSFQHLKQLPNHRV
LVMEGAGHPCYLDKPDEWHKGLLDFLQGLA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgtggaccagcatgagggcaccatcaaggtgcagggccagaacctcttcttc
agagagacccggcctgggagtgggcagcctgtccgcttctctgtgctgctgctgcatggt
atccgcttctcctcggagacttggcagaacctgggtactctgcagaggctggccgaggct
ggctacagggctgtggccattgatctgccaggtcttgggcgatccaaggaagcagcagcc
cctgcccctattggggaaccggcccctggcagcttcctagctgctgtggtggataccttg
gagctgggacccccagttgtgatcagtccatcattaagtggcatgtattcactgcccttc
ctcgtggcccccgggtcccaactccggggctttgtaccagtggctcctatctgcacagac
aaaatcaatgctgtggactacgccagtgtgaagactccagctctcattgtatatggagac
caggaccccatgggctcctccagctttcaacacctgaagcagctgcccaaccacagagtg
ctggtcatggaaggggcagggcatccctgttacttggacaagcctgatgagtggcataag
gggctgctggatttcctgcaagggctagcctga

DBGET integrated database retrieval system