KEGG   Mus musculus (mouse): 76498
Entry
76498             CDS       T01002                                 

Symbol
Paqr4, 1500004C10Rik
Name
(RefSeq) progestin and adipoQ receptor family member IV
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: HlyIII
Other DBs
NCBI-GeneID: 76498
NCBI-ProteinID: NP_076313
MGI: 1923748
Ensembl: ENSMUSG00000023909
UniProt: Q9JJE4
Position
17:complement(23955160..23959873)
AA seq 273 aa
MAFLTGPRLLDWASSPPHLQFNKFVLTGYRPASSGSGCLRSLFYLHNELGNIYTHGLALL
GFLVLVPMTMPWSQLGKDGWLGGTHCVACLVPPAASVLYHLFMCHQGGSPVYTRLLALDM
CGVCLVNTLGALPIIHCTLACRPWLRPAALMGYTALSGVAGWRALTAPSTSARLRAFGWQ
AGARLLVFGARGVGLGSGAPGSLPCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSH
QIMHLLSVGSILQLHAGVVPDLLWAAHHACPPD
NT seq 822 nt   +upstreamnt  +downstreamnt
atggcattcctgaccgggcctcgtctcctggactgggctagctcgccgccgcacctgcag
ttcaataagttcgtattaaccggctaccggccggccagcagcggctcgggctgtctgcgc
agccttttctacctacacaacgagctgggcaacatctacacacacgggctagccctgctg
ggcttcctggtgttggtgccaatgaccatgccctggagtcagctgggcaaggatggctgg
ctaggaggtacacactgtgtggcttgcctggtgccccctgcagcctctgtgctgtatcac
ctcttcatgtgccaccaaggaggcagtcctgtgtacacccggctccttgccttggatatg
tgtggagtctgccttgtcaacacccttggagccctgcccatcatccactgcactctggcc
tgcagaccgtggcttcgcccagctgccctgatgggttacactgcactgtcaggtgtagcc
ggctggagagctctcactgccccctccaccagtgcccggcttcgagcctttggttggcaa
gctggggcccgcctgctggtgtttggggcccgtggagtggggctgggctcaggggctcca
ggctctctgccctgctacctgcgcatggacgcactggctctgcttggagggctggtgaat
gtggcacgcctgccagagcggtgggggcctggtcgcttcgactactggggcaactcccac
cagatcatgcacttgctgagtgtgggctccatcctccagctccatgctggggttgtgcct
gacctgctctgggctgcacaccatgcctgtcccccagactga

DBGET integrated database retrieval system