KEGG   Mus musculus (mouse): 76527
Entry
76527             CDS       T01002                                 

Symbol
Il34, 2010004A03Rik, AI593503
Name
(RefSeq) interleukin 34
  KO
K22633  interleukin 34
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    76527 (Il34)
   04061 Viral protein interaction with cytokine and cytokine receptor
    76527 (Il34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    76527 (Il34)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   76527 (Il34)
SSDB
Motif
Pfam: IL34
Other DBs
NCBI-GeneID: 76527
NCBI-ProteinID: NP_001128572
MGI: 1923777
Ensembl: ENSMUSG00000031750
Vega: OTTMUSG00000027476
UniProt: Q8R1R4
Structure
Position
8:complement(111467809..111532579)
AA seq 235 aa
MPWGLAWLYCLGILLDVALGNENLEIWTLTQDKECDLTGYLRGKLQYKNRLQYMKHYFPI
NYRIAVPYEGVLRVANITRLQKAHVSERELRYLWVLVSLNATESVMDVLLEGHPSWKYLQ
EVQTLLENVQRSLMDVEIGPHVEAVLSLLSTPGLSLKLVRPKALLDNCFRVMELLYCSCC
KQSPILKWQDCELPRLHPHSPGSLMQCTATNVYPLSRQTPTSLPGSPSSSHGSLP
NT seq 708 nt   +upstreamnt  +downstreamnt
atgccctggggactcgcctggctatactgtcttgggatcctacttgacgtggctttggga
aacgagaatttggagatatggactctgacccaagataaggagtgtgaccttacaggctac
cttcggggcaagctgcagtacaagaaccggcttcagtacatgaaacattacttccccatc
aactacaggattgctgtgccttatgagggggtactcagagtggccaacatcacaaggctg
cagaaggctcacgtgagtgagcgagagcttcggtacctgtgggtcttggtgagtctcaat
gccactgagtctgtgatggatgtacttctcgagggccacccgtcctggaagtatctacag
gaggttcagacattgctggagaacgtacagcggagcctcatggatgtggagattggccct
cacgtggaagctgtgttatctcttctgagtactccaggcctaagcctgaagctggtgcgg
cccaaagccttgctggacaactgcttccgggtcatggaactgctgtactgttcttgctgt
aaacaaagccccatcttaaaatggcaggactgcgagctgcccaggctccatccccacagt
ccggggtccttgatgcaatgtacagctacaaatgtgtaccctttgtctcggcagaccccc
acctccctgcccggatccccaagctcaagccatggctcgttgccctga

DBGET integrated database retrieval system