KEGG   Mus musculus (house mouse): 76559
Entry
76559             CDS       T01002                                 
Symbol
Atg2b, 2410024A21Rik, C030004M05Rik, C630028L02Rik, mKIAA4067
Name
(RefSeq) autophagy related 2B
  KO
K17906  autophagy-related protein 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    76559 (Atg2b)
   04136 Autophagy - other
    76559 (Atg2b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    76559 (Atg2b)
   05014 Amyotrophic lateral sclerosis
    76559 (Atg2b)
   05016 Huntington disease
    76559 (Atg2b)
   05017 Spinocerebellar ataxia
    76559 (Atg2b)
   05022 Pathways of neurodegeneration - multiple diseases
    76559 (Atg2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    76559 (Atg2b)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    76559 (Atg2b)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    76559 (Atg2b)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    76559 (Atg2b)
SSDB
Motif
Pfam: ATG_C Chorein_N VPS13_C ATG2_CAD VPS13
Other DBs
NCBI-GeneID: 76559
NCBI-ProteinID: NP_083930
MGI: 1923809
Ensembl: ENSMUSG00000041341
UniProt: Q80XK6
Position
12:complement(105579798..105651559)
AA seq 2075 aa
MPWPFSESIKKRACRYLLQRYLGHFLQEKLSLEQLSLDLYQGTGSLAQVPLDKWCLNEIL
ESADAPLEVTEGFIQSISLSVPWGSLLQDNCALEVRGLEMVFRPRPRVATGSEPMYWSSF
MTSSMQLAKECLSQKLTDEQGEASQPFEGLEKFAETIETVLRRVKVTFIDTVLRIEHVPE
NSKTGAALEIRVDRTVYCDETADESSGVNVHQPTAFAHKLLQLSGVSLFWDEFSASAKSS
PVCSTAPVETEPKLSPSWNPKIVYEPHPQLTRTLPEIAPSDPVQIGRLLGRLELSLTLKQ
NEVLPGAKLDVDGQIDSFHLFLSPRQVHLLLDMLAAIAGPENSSKIGLANKDRKNRPMQQ
EDEYRIQMELNRYYLRKDSLSMGVSSEKSFYETETARTPSSREEEVFFSMADMDMSHSLS
SLPPLGDPPHMDLELSLTSTYTNTPAGSPLSATVLQPTWGEFADHKEQPVRGPAFQSDVV
HPASLQKAALSSRSASVDESRPEFICRLALGIFSVSVLHIDPLSPAETSLNVNPLTRMAT
DFFSCVEKMDPAIFSTGDFKSFRAVFAEACSHDHLRFIGTGIKVSYEQRQRSASRHFSTD
MSVGQMEFLECLFPTDCHSVPSHYTELLTFHSKEGTDAHLPVCLQLHYKHSETRGPQGNQ
ARLSSVPQKAELQIKLNPVCCELDISIVDRLNSLLQPQKLTTVEMMASHMYASYNKHISL
HKAFTEVFLDDSHSPANRRVSVQVATPALHLSVRFPIPDLRSDQERGPWFKKSLQKETLH
LEFTDLESKTEFVGGSTPEQTKLELTFRELSGSFQEEKGGPSVKFFHVSGGVDGDTASSD
DFDWPRMVLKINPPAMHSILERIAAEEEEENDGHYQEEEDGGAHSLKDVCDLRRPAPSPF
SSRRVMFENEQMVMPGDPVEMTEFQDKAISNSHYVLELLLPNIHLTLPNKGFYEKLYNRI
FNDLLLWEPTAPSPVETLENVSYGIGLSVASQLINTFSKDSFSPFKSAVHYDEDSGSEEE
TLQYFSAVDPNYRSRRKKKLDSQNKNSQSFLSVLLSINHGLMAVFTDVKQENGDPMESKH
GEFWLEFNSGSFFCVTKYEGFEDKHYICLHSSSLRLYHKGIVDGAILPTETRLPCSTRPH
WLEPTIYSSEEDGLSRTASDGVGGDNLNMLSVAVKILSDKSESNTKEFLVAVGLKGATLQ
HRVLPAGLSWHEQILNFLNIADEPVLGYNPPTSFTTFHVHLWSCALDYRPLHLPLRSLLT
VETFSISSSVALDKSSSTLRIIMDEAALHLSDKCNTVTVNLNRDYVRVMDMGLLELTITA
VKSDSDGEQTAPRFELHCSSDVVHIRTCSDSCAALMNLIQYVASYGDLHGPHKAEMKPGV
PQRKPKVDSSARSSSHGPVLPEADQQILRDLMSDAMEEIDLQQASAPVGPQANGVLDEKS
HTQEPCCSDLFLFPDESGNVSQESSPAYPSLTHHLISDAVTGVTAENDDFCILFAPKTVV
QEKEEEPVIKIMVDDAIVIKDDYFSLPITRTDSSKAPLHFPIPAVRYVVKEVSLVWHLYG
GKDFATAPPTSPAKSYIPHSSPSQTPTRHGRHTVCGGKGRNHDFLMEIQLSKVKFQHEVY
PPCKPECESSLLEHPVSRQVFIVQDLEIRDRLATSQMNKFLYLYCSKDMPRKAHSNMLTI
KALHVRPESGRSPQECCLRVSLMPLRLNIDQDALFFLKDFFTSLSTEVELLLTPDPEVTK
SPGADVTCSLPRHLSTSKEPNLVVSFPGPKQASPNHRANSAEGGNGLEEDVSAEETSFSD
QPVFFREFRFTAEVPIRLDYHGKHVSMDQGTLAGILIGLAQLNCSELKLKRLFYRHGLLG
IDKLFSYAISEWLSDIKKNQLPGILGGVGPMHSLVQLVQGLKDLVWLPIEQYRKDGRIVR
GFQRGAASFGTSTAMAALELTNRMVQTIQAAAETAYDMVSPSTLSIEPKKAKRFPHHRLA
HQPVDLREGVAKAYSVVKEGITDTAQTIYETAAREHESRGVTGAVGEVLRQIPPAVVRPL
IVATEATSNVLGGMRNQIRPDVRQDESQKWRHGED
NT seq 6228 nt   +upstreamnt  +downstreamnt
atgccttggccattttcagaatccatcaagaagagggcctgtcgctacctcctacagagg
tacctgggccacttcctgcaggagaagctgagcctggagcagctgagcctggatctgtac
cagggcaccgggtcccttgcccaggtccccttggacaaatggtgtctcaatgaaatcctg
gagtcagcagatgcaccattagaagtcactgaaggatttattcagtccatttccctgtcc
gtcccatggggctccttgctgcaggacaactgtgccctggaagtgagaggactggagatg
gtcttccggcctcgacctcgagtagcaactgggtccgagcctatgtactggtcaagcttc
atgaccagcagtatgcagctggcaaaggagtgccttagccagaaactgacagatgagcaa
ggagaggcatcccaacctttcgagggactggaaaagtttgcagaaaccatcgaaacagta
ctaagaagagtgaaagtcacttttatagatactgttttaagaattgaacatgtgccagaa
aattctaaaactggagctgcacttgaaatccgagtagacaggaccgtgtactgtgacgaa
acagccgacgagtcctcaggagtcaatgtgcatcagcccacagcttttgctcataaattg
ctgcagctctctggggtgtctctgttctgggatgagttttctgcttcagcaaaatcttcc
cccgtgtgttcaactgcaccagtggaaactgagccaaagctgtcacctagctggaacccc
aaaattgtttatgagccacacccacaactaactagaacgttaccggagatcgcaccctcg
gatccagtgcagattggaaggctactgggcaggctggagttgagtctcactttaaaacag
aatgaagtgcttccaggagccaagttggatgtcgatggacagatagactcctttcatcta
ttcctgtcaccgaggcaggtacacctccttctggatatgttagcagctattgctggacca
gaaaattctagcaaaatagggctggctaataaagacaggaaaaatcgacccatgcagcag
gaagatgagtacagaattcagatggaattaaaccggtattatctgaggaaagattccctc
tctatgggtgtgtcttctgagaagagcttctatgagacagaaacagctcgtacaccttct
agccgtgaggaagaagttttcttctccatggccgacatggacatgtctcacagtctgtcc
tctcttccaccccttggggacccaccacacatggacctggagctgtcgctgacgagtaca
tacaccaacacacccgcagggtccccgctaagcgccactgtgcttcagccaacttgggga
gagtttgccgaccacaaagaacagccagtcagagggccagcattccagtctgacgtggtg
cacccggcatctttacaaaaagctgctctctcctctaggtctgcttcagtggatgaatcc
agacctgagtttatctgcaggctggctctcggcatattctccgtctccgtgcttcacatc
gatcctttgtctccagcggaaacgtctctgaacgtcaacccattgacacgcatggccacc
gatttcttctcctgtgtagaaaagatggacccagcaatattttcgacgggagactttaag
tctttccgagcagtctttgccgaagcttgttcacacgatcaccttaggtttataggtact
ggcatcaaagtgtcctatgagcagagacaaaggtcagcttcccggcactttagcaccgac
atgtccgttgggcaaatggagtttttggagtgtctgtttccaacagattgtcattctgtc
ccttctcactacaccgagcttctaacgttccattccaaagaagggacggatgcccacctt
cccgtttgtcttcagcttcactataaacactcagagactagaggaccccagggtaatcaa
gcaagacttagttcagttcctcaaaaggcagaattacaaattaaattaaaccccgtgtgt
tgcgagctggatatcagtattgtggataggttaaattccttgcttcaacctcagaaactc
actaccgtggagatgatggcctcgcacatgtatgcgtcctataacaagcatattagtttg
cacaaggctttcacggaagtgttcctagatgactcacacagtcctgcaaaccgtcgggtg
tccgtacaagttgccaccccagccctgcacctgtctgttcgcttccctattcctgatcta
agatcagaccaggaaagaggaccctggtttaagaagtcacttcagaaggagacccttcat
ttagaatttacggatctggagtccaagacagagttcgtgggaggatccaccccagaacaa
actaaactggagctgacttttcgagagctatctgggtcgttccaggaggagaagggaggg
ccatctgtcaagttcttccatgtgtctggtggagtagatggagacaccgcatcgtcagat
gactttgactggccacgaatggtactgaaaataaacccaccagccatgcattccattttg
gagagaatagcagccgaggaagaggaagagaatgatggtcactaccaggaggaggaggac
ggaggggctcattccctgaaagatgtctgtgacctgaggcggccagccccgtctcccttt
tcctctcgtcgagtgatgtttgagaatgagcagatggtgatgccgggagaccctgtggag
atgacggagtttcaggataaagccatcagcaactcgcactacgtgctggagctcctgttg
cccaacatccacctgacgctgcccaacaaaggcttctacgagaagctctataacaggatc
tttaacgacttgcttctctgggagccaacagcgccttcaccagtggagacacttgaaaac
gtttcctatggcatcggactctccgtggccagtcagctgatcaataccttcagcaaagat
agcttcagtccctttaaatctgcagttcactatgatgaagacagtggatctgaagaagag
actttgcagtatttttctgctgttgatcccaactatcgttcccgtaggaaaaaaaagttg
gactctcagaacaagaactctcagagcttcctctcagtgcttctgagtatcaatcatgga
ctaatggcagtgttcactgatgtgaagcaagagaatggagatccgatggaaagtaagcat
ggtgaattctggctagaattcaatagcggctcgttcttctgcgtgacaaagtatgagggc
tttgaggacaagcactacatctgcttgcattccagcagcctcaggctgtaccacaaaggc
atagtagatggagccattctccctacagagacgcgcttgccctgttccacccgcccacac
tggctggaacctacaatttattcctctgaagaagatggcctcagccgcactgcctcagat
ggggttgggggagacaatttgaatatgctctcagtcgcagtgaagatactgtctgataag
tccgagtccaacacgaaggagttcctcgtggctgtggggctgaaaggagccactctacag
cacagggtgctgcccgctggactcagttggcacgagcagattttaaacttcttgaatatt
gctgatgaacctgttttgggatataaccctccaacttcatttacaactttccatgtccat
ctttggagctgtgcacttgattacaggccccttcacctgccactccgatcccttcttact
gttgagacgttcagcatttctagcagtgttgctttggataaatcttcctccactctcaga
atcatcatggacgaggctgctttgcacctgtcagacaagtgcaacacggtcactgtaaac
ctgaatagagattatgttcgtgtgatggacatgggacttttagagctgaccataaccgca
gtaaaatctgattctgatggagaacagactgcgccccgctttgagttacactgttccagt
gacgtcgtgcacatcagaacatgctcagactcatgtgctgcgctgatgaacctcattcag
tatgtcgcaagttacggggacctacatggacctcacaaagcagagatgaagcctggagtc
ccacagagaaagcccaaggtagattccagcgctcggtcatcttcacatggtccagtgctt
cctgaagcagatcagcagattttacgggacctgatgagtgatgccatggaggagattgat
ctgcagcaggcctctgcccctgtcggaccacaggctaatggtgtcctggatgaaaagtct
cacactcaggagccgtgctgttcagacctcttcctgttcccagatgagagtggaaatgtg
tcccaggagtccagccctgcctatccgtctctcactcaccacttgatcagtgacgcggtg
accggtgtgaccgctgaaaatgatgacttctgtattctttttgcaccaaaaacagtcgtt
caggagaaggaagaagagccagtgataaagatcatggttgacgacgccattgtgataaaa
gatgactatttcagtctgcccatcacgaggacagacagcagcaaagcgccgctccacttt
cccatccctgccgtccgatatgttgttaaagaggtctctctggtgtggcatctttatgga
ggcaaggactttgcaacagctcctccaacttctccagctaagagttacattccccacagc
tcaccgtctcaaacacctacaaggcacgggcgccacacagtctgtgggggcaaaggaagg
aaccatgacttcttgatggaaatacagttaagcaaggtgaagtttcagcatgaggtctac
cctccgtgtaagcctgagtgtgagtccagcctcttagaacacccagtctccaggcaggtc
ttcatcgtgcaggaccttgaaattcgagatcggctggcaacatcacagatgaataagttt
ttatacctgtattgcagcaaagacatgcctcgtaaagcccattccaacatgctgacaatt
aaagcgttgcatgtacgtccggagtctggcaggtcaccacaggagtgctgcttgagagtg
tccctgatgcctcttcgcctcaatattgaccaggacgccttgttcttcctcaaggatttc
ttcacaagtctttctacagaagtggagcttctactgactccagatccagaagttacaaag
tctcctggagctgatgtcacctgcagtttgccaaggcatttgagtacctcaaaggagcca
aatctagtcgtttcttttcctgggccaaaacaagcttccccgaaccatcgtgccaattca
gcggagggtggtaatggactggaggaggacgtctctgctgaggaaacttcatttagtgac
cagcctgtgttttttagagaatttagattcacggcagaagttcccatccggcttgactac
cacggcaagcacgtgtcgatggatcagggtacattggctgggattttgattggcctggcc
cagttgaactgttcggagctaaagctgaaaaggcttttctatcggcatggtttgctaggt
attgacaaattgttctcatatgcaatctcggaatggctcagtgacattaagaagaaccag
ctaccaggaatcctgggaggtgttggccctatgcattcactagttcaattagtgcaaggc
ctgaaggacttggtatggctgcccattgagcaataccggaaggatggccgtatcgtcaga
ggcttccagaggggcgctgcttcctttggtacctcaactgcaatggctgccctggaactc
acaaacagaatggtccaaaccatacaggcagccgcagagactgcatatgacatggtgtct
ccgagtaccctttccattgagcccaagaaggcaaagagatttcctcatcaccggttagcc
caccagccagtagacctgagggaaggcgtggccaaggcctacagcgttgtaaaagagggg
atcacagacacagctcagaccatctatgaaacggcggctcgggaacacgagagcagaggg
gtcactggtgctgtgggtgaagtcctgcggcagatcccaccggcagtggtcagacccctg
attgtagccaccgaggcgacatcaaatgtgttaggtggcatgagaaaccaaattagacca
gacgttcggcaggacgagtcgcagaaatggcgccatggggaggactga

DBGET integrated database retrieval system