KEGG   Mus musculus (mouse): 76559Help
Entry
76559             CDS       T01002                                 

Gene name
Atg2b, 2410024A21Rik, AI047755, AI503411, AW558123, C030004M05Rik, C630028L02Rik, mKIAA4067
Definition
(RefSeq) autophagy related 2B
  KO
K17906  autophagy-related protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
mmu05010  Alzheimer disease
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    76559 (Atg2b)
   04136 Autophagy - other
    76559 (Atg2b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    76559 (Atg2b)
   05016 Huntington disease
    76559 (Atg2b)
   05017 Spinocerebellar ataxia
    76559 (Atg2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    76559 (Atg2b)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    76559 (Atg2b)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    76559 (Atg2b)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    76559 (Atg2b)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    76559 (Atg2b)
Transporters [BR:mmu02000]
 Other transporters
  Others
   76559 (Atg2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG_C Chorein_N VPS13_C ATG2_CAD VPS13
Motif
Other DBs
NCBI-GeneID: 76559
NCBI-ProteinID: NP_083930
MGI: 1923809
Ensembl: ENSMUSG00000041341
UniProt: Q80XK6
Position
12; 12 E
AA seq 2075 aa AA seqDB search
MPWPFSESIKKRACRYLLQRYLGHFLQEKLSLEQLSLDLYQGTGSLAQVPLDKWCLNEIL
ESADAPLEVTEGFIQSISLSVPWGSLLQDNCALEVRGLEMVFRPRPRVATGSEPMYWSSF
MTSSMQLAKECLSQKLTDEQGEASQPFEGLEKFAETIETVLRRVKVTFIDTVLRIEHVPE
NSKTGAALEIRVDRTVYCDETADESSGVNVHQPTAFAHKLLQLSGVSLFWDEFSASAKSS
PVCSTAPVETEPKLSPSWNPKIVYEPHPQLTRTLPEIAPSDPVQIGRLLGRLELSLTLKQ
NEVLPGAKLDVDGQIDSFHLFLSPRQVHLLLDMLAAIAGPENSSKIGLANKDRKNRPMQQ
EDEYRIQMELNRYYLRKDSLSMGVSSEKSFYETETARTPSSREEEVFFSMADMDMSHSLS
SLPPLGDPPHMDLELSLTSTYTNTPAGSPLSATVLQPTWGEFADHKEQPVRGPAFQSDVV
HPASLQKAALSSRSASVDESRPEFICRLALGIFSVSVLHIDPLSPAETSLNVNPLTRMAT
DFFSCVEKMDPAIFSTGDFKSFRAVFAEACSHDHLRFIGTGIKVSYEQRQRSASRHFSTD
MSVGQMEFLECLFPTDCHSVPSHYTELLTFHSKEGTDAHLPVCLQLHYKHSETRGPQGNQ
ARLSSVPQKAELQIKLNPVCCELDISIVDRLNSLLQPQKLTTVEMMASHMYASYNKHISL
HKAFTEVFLDDSHSPANRRVSVQVATPALHLSVRFPIPDLRSDQERGPWFKKSLQKETLH
LEFTDLESKTEFVGGSTPEQTKLELTFRELSGSFQEEKGGPSVKFFHVSGGVDGDTASSD
DFDWPRMVLKINPPAMHSILERIAAEEEEENDGHYQEEEDGGAHSLKDVCDLRRPAPSPF
SSRRVMFENEQMVMPGDPVEMTEFQDKAISNSHYVLELLLPNIHLTLPNKGFYEKLYNRI
FNDLLLWEPTAPSPVETLENVSYGIGLSVASQLINTFSKDSFSPFKSAVHYDEDSGSEEE
TLQYFSAVDPNYRSRRKKKLDSQNKNSQSFLSVLLSINHGLMAVFTDVKQENGDPMESKH
GEFWLEFNSGSFFCVTKYEGFEDKHYICLHSSSLRLYHKGIVDGAILPTETRLPCSTRPH
WLEPTIYSSEEDGLSRTASDGVGGDNLNMLSVAVKILSDKSESNTKEFLVAVGLKGATLQ
HRVLPAGLSWHEQILNFLNIADEPVLGYNPPTSFTTFHVHLWSCALDYRPLHLPLRSLLT
VETFSISSSVALDKSSSTLRIIMDEAALHLSDKCNTVTVNLNRDYVRVMDMGLLELTITA
VKSDSDGEQTAPRFELHCSSDVVHIRTCSDSCAALMNLIQYVASYGDLHGPHKAEMKPGV
PQRKPKVDSSARSSSHGPVLPEADQQILRDLMSDAMEEIDLQQASAPVGPQANGVLDEKS
HTQEPCCSDLFLFPDESGNVSQESSPAYPSLTHHLISDAVTGVTAENDDFCILFAPKTVV
QEKEEEPVIKIMVDDAIVIKDDYFSLPITRTDSSKAPLHFPIPAVRYVVKEVSLVWHLYG
GKDFATAPPTSPAKSYIPHSSPSQTPTRHGRHTVCGGKGRNHDFLMEIQLSKVKFQHEVY
PPCKPECESSLLEHPVSRQVFIVQDLEIRDRLATSQMNKFLYLYCSKDMPRKAHSNMLTI
KALHVRPESGRSPQECCLRVSLMPLRLNIDQDALFFLKDFFTSLSTEVELLLTPDPEVTK
SPGADVTCSLPRHLSTSKEPNLVVSFPGPKQASPNHRANSAEGGNGLEEDVSAEETSFSD
QPVFFREFRFTAEVPIRLDYHGKHVSMDQGTLAGILIGLAQLNCSELKLKRLFYRHGLLG
IDKLFSYAISEWLSDIKKNQLPGILGGVGPMHSLVQLVQGLKDLVWLPIEQYRKDGRIVR
GFQRGAASFGTSTAMAALELTNRMVQTIQAAAETAYDMVSPSTLSIEPKKAKRFPHHRLA
HQPVDLREGVAKAYSVVKEGITDTAQTIYETAAREHESRGVTGAVGEVLRQIPPAVVRPL
IVATEATSNVLGGMRNQIRPDVRQDESQKWRHGED
NT seq 6228 nt NT seq  +upstreamnt  +downstreamnt
atgccttggccattttcagaatccatcaagaagagggcctgtcgctacctcctacagagg
tacctgggccacttcctgcaggagaagctgagcctggagcagctgagcctggatctgtac
cagggcaccgggtcccttgcccaggtccccttggacaaatggtgtctcaatgaaatcctg
gagtcagcagatgcaccattagaagtcactgaaggatttattcagtccatttccctgtcc
gtcccatggggctccttgctgcaggacaactgtgccctggaagtgagaggactggagatg
gtcttccggcctcgacctcgagtagcaactgggtccgagcctatgtactggtcaagcttc
atgaccagcagtatgcagctggcaaaggagtgccttagccagaaactgacagatgagcaa
ggagaggcatcccaacctttcgagggactggaaaagtttgcagaaaccatcgaaacagta
ctaagaagagtgaaagtcacttttatagatactgttttaagaattgaacatgtgccagaa
aattctaaaactggagctgcacttgaaatccgagtagacaggaccgtgtactgtgacgaa
acagccgacgagtcctcaggagtcaatgtgcatcagcccacagcttttgctcataaattg
ctgcagctctctggggtgtctctgttctgggatgagttttctgcttcagcaaaatcttcc
cccgtgtgttcaactgcaccagtggaaactgagccaaagctgtcacctagctggaacccc
aaaattgtttatgagccacacccacaactaactagaacgttaccggagatcgcaccctcg
gatccagtgcagattggaaggctactgggcaggctggagttgagtctcactttaaaacag
aatgaagtgcttccaggagccaagttggatgtcgatggacagatagactcctttcatcta
ttcctgtcaccgaggcaggtacacctccttctggatatgttagcagctattgctggacca
gaaaattctagcaaaatagggctggctaataaagacaggaaaaatcgacccatgcagcag
gaagatgagtacagaattcagatggaattaaaccggtattatctgaggaaagattccctc
tctatgggtgtgtcttctgagaagagcttctatgagacagaaacagctcgtacaccttct
agccgtgaggaagaagttttcttctccatggccgacatggacatgtctcacagtctgtcc
tctcttccaccccttggggacccaccacacatggacctggagctgtcgctgacgagtaca
tacaccaacacacccgcagggtccccgctaagcgccactgtgcttcagccaacttgggga
gagtttgccgaccacaaagaacagccagtcagagggccagcattccagtctgacgtggtg
cacccggcatctttacaaaaagctgctctctcctctaggtctgcttcagtggatgaatcc
agacctgagtttatctgcaggctggctctcggcatattctccgtctccgtgcttcacatc
gatcctttgtctccagcggaaacgtctctgaacgtcaacccattgacacgcatggccacc
gatttcttctcctgtgtagaaaagatggacccagcaatattttcgacgggagactttaag
tctttccgagcagtctttgccgaagcttgttcacacgatcaccttaggtttataggtact
ggcatcaaagtgtcctatgagcagagacaaaggtcagcttcccggcactttagcaccgac
atgtccgttgggcaaatggagtttttggagtgtctgtttccaacagattgtcattctgtc
ccttctcactacaccgagcttctaacgttccattccaaagaagggacggatgcccacctt
cccgtttgtcttcagcttcactataaacactcagagactagaggaccccagggtaatcaa
gcaagacttagttcagttcctcaaaaggcagaattacaaattaaattaaaccccgtgtgt
tgcgagctggatatcagtattgtggataggttaaattccttgcttcaacctcagaaactc
actaccgtggagatgatggcctcgcacatgtatgcgtcctataacaagcatattagtttg
cacaaggctttcacggaagtgttcctagatgactcacacagtcctgcaaaccgtcgggtg
tccgtacaagttgccaccccagccctgcacctgtctgttcgcttccctattcctgatcta
agatcagaccaggaaagaggaccctggtttaagaagtcacttcagaaggagacccttcat
ttagaatttacggatctggagtccaagacagagttcgtgggaggatccaccccagaacaa
actaaactggagctgacttttcgagagctatctgggtcgttccaggaggagaagggaggg
ccatctgtcaagttcttccatgtgtctggtggagtagatggagacaccgcatcgtcagat
gactttgactggccacgaatggtactgaaaataaacccaccagccatgcattccattttg
gagagaatagcagccgaggaagaggaagagaatgatggtcactaccaggaggaggaggac
ggaggggctcattccctgaaagatgtctgtgacctgaggcggccagccccgtctcccttt
tcctctcgtcgagtgatgtttgagaatgagcagatggtgatgccgggagaccctgtggag
atgacggagtttcaggataaagccatcagcaactcgcactacgtgctggagctcctgttg
cccaacatccacctgacgctgcccaacaaaggcttctacgagaagctctataacaggatc
tttaacgacttgcttctctgggagccaacagcgccttcaccagtggagacacttgaaaac
gtttcctatggcatcggactctccgtggccagtcagctgatcaataccttcagcaaagat
agcttcagtccctttaaatctgcagttcactatgatgaagacagtggatctgaagaagag
actttgcagtatttttctgctgttgatcccaactatcgttcccgtaggaaaaaaaagttg
gactctcagaacaagaactctcagagcttcctctcagtgcttctgagtatcaatcatgga
ctaatggcagtgttcactgatgtgaagcaagagaatggagatccgatggaaagtaagcat
ggtgaattctggctagaattcaatagcggctcgttcttctgcgtgacaaagtatgagggc
tttgaggacaagcactacatctgcttgcattccagcagcctcaggctgtaccacaaaggc
atagtagatggagccattctccctacagagacgcgcttgccctgttccacccgcccacac
tggctggaacctacaatttattcctctgaagaagatggcctcagccgcactgcctcagat
ggggttgggggagacaatttgaatatgctctcagtcgcagtgaagatactgtctgataag
tccgagtccaacacgaaggagttcctcgtggctgtggggctgaaaggagccactctacag
cacagggtgctgcccgctggactcagttggcacgagcagattttaaacttcttgaatatt
gctgatgaacctgttttgggatataaccctccaacttcatttacaactttccatgtccat
ctttggagctgtgcacttgattacaggccccttcacctgccactccgatcccttcttact
gttgagacgttcagcatttctagcagtgttgctttggataaatcttcctccactctcaga
atcatcatggacgaggctgctttgcacctgtcagacaagtgcaacacggtcactgtaaac
ctgaatagagattatgttcgtgtgatggacatgggacttttagagctgaccataaccgca
gtaaaatctgattctgatggagaacagactgcgccccgctttgagttacactgttccagt
gacgtcgtgcacatcagaacatgctcagactcatgtgctgcgctgatgaacctcattcag
tatgtcgcaagttacggggacctacatggacctcacaaagcagagatgaagcctggagtc
ccacagagaaagcccaaggtagattccagcgctcggtcatcttcacatggtccagtgctt
cctgaagcagatcagcagattttacgggacctgatgagtgatgccatggaggagattgat
ctgcagcaggcctctgcccctgtcggaccacaggctaatggtgtcctggatgaaaagtct
cacactcaggagccgtgctgttcagacctcttcctgttcccagatgagagtggaaatgtg
tcccaggagtccagccctgcctatccgtctctcactcaccacttgatcagtgacgcggtg
accggtgtgaccgctgaaaatgatgacttctgtattctttttgcaccaaaaacagtcgtt
caggagaaggaagaagagccagtgataaagatcatggttgacgacgccattgtgataaaa
gatgactatttcagtctgcccatcacgaggacagacagcagcaaagcgccgctccacttt
cccatccctgccgtccgatatgttgttaaagaggtctctctggtgtggcatctttatgga
ggcaaggactttgcaacagctcctccaacttctccagctaagagttacattccccacagc
tcaccgtctcaaacacctacaaggcacgggcgccacacagtctgtgggggcaaaggaagg
aaccatgacttcttgatggaaatacagttaagcaaggtgaagtttcagcatgaggtctac
cctccgtgtaagcctgagtgtgagtccagcctcttagaacacccagtctccaggcaggtc
ttcatcgtgcaggaccttgaaattcgagatcggctggcaacatcacagatgaataagttt
ttatacctgtattgcagcaaagacatgcctcgtaaagcccattccaacatgctgacaatt
aaagcgttgcatgtacgtccggagtctggcaggtcaccacaggagtgctgcttgagagtg
tccctgatgcctcttcgcctcaatattgaccaggacgccttgttcttcctcaaggatttc
ttcacaagtctttctacagaagtggagcttctactgactccagatccagaagttacaaag
tctcctggagctgatgtcacctgcagtttgccaaggcatttgagtacctcaaaggagcca
aatctagtcgtttcttttcctgggccaaaacaagcttccccgaaccatcgtgccaattca
gcggagggtggtaatggactggaggaggacgtctctgctgaggaaacttcatttagtgac
cagcctgtgttttttagagaatttagattcacggcagaagttcccatccggcttgactac
cacggcaagcacgtgtcgatggatcagggtacattggctgggattttgattggcctggcc
cagttgaactgttcggagctaaagctgaaaaggcttttctatcggcatggtttgctaggt
attgacaaattgttctcatatgcaatctcggaatggctcagtgacattaagaagaaccag
ctaccaggaatcctgggaggtgttggccctatgcattcactagttcaattagtgcaaggc
ctgaaggacttggtatggctgcccattgagcaataccggaaggatggccgtatcgtcaga
ggcttccagaggggcgctgcttcctttggtacctcaactgcaatggctgccctggaactc
acaaacagaatggtccaaaccatacaggcagccgcagagactgcatatgacatggtgtct
ccgagtaccctttccattgagcccaagaaggcaaagagatttcctcatcaccggttagcc
caccagccagtagacctgagggaaggcgtggccaaggcctacagcgttgtaaaagagggg
atcacagacacagctcagaccatctatgaaacggcggctcgggaacacgagagcagaggg
gtcactggtgctgtgggtgaagtcctgcggcagatcccaccggcagtggtcagacccctg
attgtagccaccgaggcgacatcaaatgtgttaggtggcatgagaaaccaaattagacca
gacgttcggcaggacgagtcgcagaaatggcgccatggggaggactga

DBGET integrated database retrieval system