KEGG   Mus musculus (mouse): 76563
Entry
76563             CDS       T01002                                 

Gene name
Qrsl1, 2700038P16Rik, C80053, Ga, GatA
Definition
(RefSeq) glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00970  Aminoacyl-tRNA biosynthesis
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    76563 (Qrsl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    76563 (Qrsl1)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     76563 (Qrsl1)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     76563 (Qrsl1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    76563 (Qrsl1)
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-GeneID: 76563
NCBI-ProteinID: NP_001074523
MGI: 1923813
Ensembl: ENSMUSG00000019863
Vega: OTTMUSG00000023049
UniProt: Q9CZN8
Position
10; 10 B2
AA seq 525 aa
MLGRTLREVSAALKQGQVTPTELCKNCLSLIKKTKYLNAYITVSEEVALKQAEESEKRYK
QGQSLGDLDGIPVAVKDNFSTTGIETTCASNMLKGYVPPYNATVVQKLLDQGALLMGKTN
LDEFAMGSGSTDGVFGPVRNPWTYSKQYRERSRQDAGDDSHWLITGGSSGGSAAAVAAFT
CFAALGSDTGGSTRNPAAHCGIVGFKPSYGLVSRHGLIPLVNSMDVPGILTRCVDDTAIV
LGTLAGHDPKDSTTVRNPAQPASVPGGMDVSRLCIGIPKEYLVPELSSEVRSLWSQAADL
FESEGAKVIEVSLPHTCYSIVCYHVLCTSEVASNMARFDGLQYGHRSGVDVSTEAMYAAT
RQEGFNDVVRGRILSGNFFLLKENYENYFVKAQKVRRLIVKDFVDVFESGVDVLLTPTTL
TEAVPYLEFIKEDNRTRSAQDDIFTQAVNMAGLPAVSVPVALSNQGLPIGLQLIGRAFCD
QQLLTVAKWFEKQVQFPVIQLQGLMDDGSLVLENGKLTSASLTQR
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgctgggccggactctccgagaagtttctgcggcactgaagcagggccaggttacacca
acagagctctgcaagaactgtctctccctcatcaagaaaaccaagtatctaaatgcttac
attactgtatcagaagaggtcgctttaaagcaagctgaagaatcagagaaaagatacaag
caaggtcagtctcttggagatttagatggaattcctgttgctgtgaaagacaactttagc
acaactggcattgagacaacatgtgcatcaaatatgttaaaaggttacgtaccaccttac
aatgctacagtagttcagaagctgttggatcagggtgccctactcatggggaaaacaaat
ttagatgagtttgctatggggtctggaagcacagatggtgtgtttgggccagttagaaac
ccctggacttactcgaagcagtacagagagagaagccggcaggatgcaggtgatgattcc
cactggctgatcactggcggaagctcgggcggcagcgcagcagccgtggccgcgttcacc
tgctttgcggctctcggatcggacactggtgggtccaccaggaaccctgctgcccactgt
gggattgttggtttcaaaccaagctatggcttggtttcacggcacggccttattcccctg
gtgaattcaatggacgtgccaggaatcctcaccagatgtgtggacgacacagcaattgtg
ttaggtacactggctggacatgaccccaaagattccaccacagtgagaaaccctgctcag
ccggcctcggttcccggcgggatggatgtgagcaggctgtgtataggaatcccaaaggaa
tatctagtaccagaattgtcaagtgaagtacggtctctctggtcccaagctgctgacctc
tttgagtctgaaggagccaaagtgattgaggtgtctctgccacacacctgttactcaatt
gtctgctaccatgtcctgtgcacatcagaagtagcatcgaatatggcaagatttgatggg
ctccagtatggtcataggtctggtgttgatgtgtccactgaagccatgtacgccgcaacc
agacaggaaggcttcaatgatgtggtgagaggaagaattctctcaggaaactttttctta
ttaaaagaaaattatgagaattatttcgtcaaggcacagaaagtgaggcgcctcattgtg
aaggattttgtggatgtttttgagtctggggtggatgtcctgctaacccccaccaccctg
actgaggcagtgccgtacctggagttcatcaaagaagacaacaggacacgcagcgcccag
gatgatattttcactcaagctgtcaatatggcaggcttgccagcagtgagtgtccctgtg
gccctctcaaaccaagggctgccaataggactgcagttaattggacgtgcattttgtgac
cagcaacttctgacagttgccaagtggtttgaaaaacaagtacagtttcctgttattcaa
ctgcagggcctcatggatgatggctcgttggttcttgaaaatggaaagttaacgtctgct
tctctgacccagagatga

DBGET integrated database retrieval system