KEGG   Mus musculus (mouse): 76568
Entry
76568             CDS       T01002                                 

Symbol
Ift46, 1500035H01Rik, AA408110, AI663846, R75047, c11orf2
Name
(RefSeq) intraflagellar transport 46
  KO
K19682  intraflagellar transport protein 46
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    76568 (Ift46)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Intraflagellar transport (IFT) complex B
    76568 (Ift46)
SSDB
Motif
Pfam: IFT46_B_C DUF1232
Other DBs
NCBI-GeneID: 76568
NCBI-ProteinID: NP_076320
MGI: 1923818
Ensembl: ENSMUSG00000002031
Vega: OTTMUSG00000026615
UniProt: Q9DB07
Position
9; 9 A5.2
AA seq 301 aa
MADNSSDEYEEDNKEKKKPSQLTPQQGFSENDDDDDDDSSETDSDDDDDDEEHGAPLEGA
YDPADYEHLPVSAEIKELFEYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPD
GKPDHLGLLVLDEPSTKQSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAIDTWI
ESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEFEELLGKVSLPTVEIDCSLAEYIDMI
CAILDIPFYKSRIQSLHLLFSLYSEFKNSQHFKALAEGKKVFTPPPNSASQAGDAETLTF
I
NT seq 906 nt   +upstreamnt  +downstreamnt
atggctgataacagcagtgacgagtacgaggaggacaataaggagaagaagaagccctcc
cagctgacaccgcagcagggcttcagtgagaacgatgatgatgacgacgatgactcctct
gagacggattccgatgacgacgatgacgatgaggagcatggagcacctctggaaggggcg
tatgatcctgccgactacgagcatctgccagtctcggccgagatcaaggagctctttgag
tacatcagccggtacacacctcagttgatcgatctggaccacaaactgaaacctttcatt
cctgattttatcccagctgttggggatatcgatgcatttttaaaggtgccacgtcccgat
ggaaagcctgaccaccttggcctcttggtgttagatgaaccatcgacaaagcagtcggac
cctaccgtgctttcgctgtggttaacagagaattccaagcagcataatattacgcaacat
atgaaagtaaagagcctggaggatgcagagaagaatcccaaagccattgacacctggatt
gagagcatctctgagttacaccgttccaagccccctgcaactgtgcactacaccaggccc
atgcccgacattgacactctgatgcaggagtggtccccggaatttgaagagctcctggga
aaggtgagtctgcccactgtcgagatcgattgcagcctggctgagtacattgacatgatc
tgtgcgatcctggacattcctttctataagagccggattcagtctctccacctgctcttt
tccctctactcagagttcaagaactcccagcattttaaagctcttgctgaaggcaaaaaa
gtattcacccctccacccaactctgcctcccaggctggggatgcggagacactgactttc
atctga

DBGET integrated database retrieval system