KEGG   Mus musculus (mouse): 76651
Entry
76651             CDS       T01002                                 

Gene name
1700122O11Rik
Definition
(RefSeq) RIKEN cDNA 1700122O11 gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Eaf7
Other DBs
NCBI-GeneID: 76651
NCBI-ProteinID: NP_083965
MGI: 1923901
Ensembl: ENSMUSG00000094928
Vega: OTTMUSG00000045505
UniProt: Q9D996 J3QPW6
Position
17; 17 C
AA seq 241 aa
MEWHGHVPWPVSHWPSDFGEERWVNSIFSPMSKISSLEDIWNKIKLEEEEEEEETGKENV
DQEQEKEEQNRIKALLGVPKQNSVWGLMAWPRPSPEQAQWWEDFSLPSLRGTCLCGCRLS
SKMRLHPLPSMTSCPTPKTLPSLGSREESSWLRNQPLMEPLSASRLKMPKAVPRLPPKVS
PKRSTMPKTGQQQTAMSMWPPVIINPPSKSSALKGQHTPSAKEVTHTPGAWGNPLPHLPS
K
NT seq 726 nt   +upstreamnt  +downstreamnt
atggagtggcatgggcatgtcccgtggcctgtcagccactggccaagtgactttggagag
gaaagatgggtgaattctatcttcagtcctatgtccaagatctcatcattggaagatatt
tggaacaaaataaaacttgaggaagaggaggaagaagaagaaacagggaaggagaatgta
gaccaagagcaagagaaagaagaacaaaacaggatcaaggcccttcttggagtacccaag
cagaactcagtgtggggcctgatggcttggcccaggccctccccagagcaagcccagtgg
tgggaagatttctccctgccctcactccgtggaacctgcctctgcggctgcagattgagc
tcaaagatgaggctccaccccctaccctccatgacttcctgccccacccctaaaaccttg
ccctcattgggatctagagaagagtctagctggctaagaaaccagcctctgatggagcct
ctatcagcgtccagattgaagatgcccaaagcagttcccagacttccacccaaggtctcc
cctaagagatctactatgcccaagacagggcaacagcagaccgcaatgtcaatgtggcct
ccggttattatcaaccctccctccaagagctctgctcttaagggacaacacacaccctct
gccaaagaggtcacccacaccccaggtgcctggggcaaccctttgcctcatcttccttca
aaataa

DBGET integrated database retrieval system