KEGG   Mus musculus (mouse): 76707
Entry
76707             CDS       T01002                                 

Gene name
Clasp1, 1700030C23Rik, 5730583A19Rik, B130045P17Rik, CL, CLA, CLASP1alpha, mCL
Definition
(RefSeq) CLIP associating protein 1
  KO
K16578  CLIP-associating protein 1/2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    76707 (Clasp1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    76707 (Clasp1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Microtubule-associated proteins
     76707 (Clasp1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Cytoplasmic linker proteins (CLIPs)
     CLIP-associating proteins
      76707 (Clasp1)
SSDB
Motif
Pfam: CLASP_N HEAT HEAT_2 HEAT_EZ Sec7_N Cnd1 RTP1_C1 TFCD_C MMS19_N ParcG TAN
Other DBs
NCBI-GeneID: 76707
NCBI-ProteinID: NP_001280229
MGI: 1923957
Ensembl: ENSMUSG00000064302
Vega: OTTMUSG00000048576
UniProt: Q80TV8 A5D6Q8 A0A087WQ31
Position
1; 1 E2.3
AA seq 1552 aa
MEPRMESCLAQVLQKDVGKRLQVGQELIDYFSDRQKSADLEHDQTLLDKLVDGLATSWVN
SSNYKVVLLGMDILSALVTRLQDRFKAQIGTVLPSLIDRLGDAKDSVREQDQTLLLKIMD
QAANPQYVWDRMLGGFKHKNFRTREGICLCLIATLNASGAQTLTLSKIVPHICNLLGDPN
SQVRDAAINSLVEIYRHVGERVRADLSKKGLPQSRLNVIFTKFDEVQKSGNMIQSANEKN
FDDEDSVDGNRPSSASSSSSKAPSSSRRNVNLGTTRRLMSSSLGSKSSAAKEGAGAVDEE
DFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYD
NFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPN
SAKIMATSGVVAVRLIIRHTHIPRLIPVITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSL
ERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHL
KNSDSIVSLPQSDRSSSSSQESLNRPLSAKRSPTGSTASRGSTVSTKSVSTTGSLQRSRS
DIDVNAAASAKSKVSSSSGSPAFSSAAALPPGSYASLDGTTTKAEGRIRTRRQSSGSTTN
VASTPSDSRGRSRAKVVSQSQRSRSANPAGAGSRSSSPGKLLGSGLAGGSSRGPPVTPSS
EKRSKIPRSQGCSRETSPNRIGLARSSRIPRPSMSQGCSRDTSRESSRDTSPARGFTPLD
RFGLGQSGRIPGSVNAMRVLSTSTDLEAAVADALLLGDARSKKKPVRRRYEPYGMYSDDD
ANSDASSVCSERSYGSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQ
RTLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKK
MGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLA
RQMDPTDFVNSSETRLAVSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALP
KTFQDGATKLLHNHLKNSSNTGVGSPSNTIGRTPSRHPSSRTSPLTSPTNCSHGGLSPSR
LWGWSADGLSKPPPPFSQPNSIPTAPSHKTLRRSYSPSMLDYDTENLNSEEIYSSLRGVT
EAIEKFSFRSQEDLNEPIKRDGKKDCDIVSRDGGAASPATEGRGGSEIEGGRMALDNKTS
LLNTQPPRAFPGPRAREYNPYPYSDTINTYDKTALKEAVFDDDMEQLRDVPIDHSDLVAD
LLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKDHSIRALA
LRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKV
LCPIIQTADYPINLAAIKMQTKVVERITKESLLQLLVDIIPGLLQGYDNTESSVRKASVF
CLVAIYSVIGEDLKPHLAQLTGSKMKLLNLYIKRAQTTNSNSSSSSDVSTHS
NT seq 4659 nt   +upstreamnt  +downstreamnt
atggaaccgagaatggagtcctgtctggcccaggtgctgcagaaggatgtgggaaagcgg
ctgcaggttggccaggaactcatagactatttctcagacagacagaagtctgctgacctt
gagcacgaccagaccctgttggataagcttgtggatggactcgctacctcttgggtgaac
tctagcaattacaaggtggttctcttgggcatggacatcctgtcggcactggtgactagg
ctgcaggaccggttcaaggcgcaaatcggcacagtgttgccaagtctaatagacagactg
ggagatgctaaagactccgtgagggagcaagaccaaaccctgctgctaaagatcatggat
caagctgctaatccccagtatgtgtgggacagaatgctcggaggcttcaaacacaagaac
ttccgcacaagagagggcatctgcctctgccttattgcaacactcaatgcctctggggcc
cagactctaacactaagcaagattgtgccacatatatgtaacctactgggagatcccaac
agccaggttcgagacgcagcaataaacagtctggtggagatttatagacatgtaggtgaa
cgtgtgagggcagacctcagtaagaaaggactgccacagtcccggttgaatgtcattttt
acaaaatttgatgaagtccaaaagtctggaaatatgatacagtctgcaaatgaaaaaaat
tttgatgatgaagattctgtggatggcaacaggccttcttctgccagctcctcatcatcc
aaggccccatcaagttcccggaggaatgttaacctggggaccacccgtaggctcatgtca
tccagtcttggatctaagtcttcagctgcaaaagaaggcgctggtgctgtggatgaagag
gattttattaaagcctttgatgatgtacctgtagtgcagatttactccagccgagacctc
gaggaatccataaacaaaatcagagaaatcctgtcagatgacaagcatgactgggagcag
agagtaaatgctctaaaaaagattagatcgttactcttggctggggctgctgagtacgat
aacttctttcaacacttgcgtcttctggacggggcctttaaactctctgctaaggacctg
cggtctcaggtagtgcgggaagcttgtatcacattggggcatctgtcatcagttctggga
aataagtttgatcatggagctgaagccattatgccaactatctttaatttaatcccgaac
agtgccaaaattatggctacttctggtgttgtagctgttaggctaatcattcggcacact
cacatccctcggctgatccctgtcataaccagcaactgtacctctaagtctgtcgccgtc
agaaggcgctgttttgaatttttagatttgcttttacaagaatggcagacacattcacta
gaaagacatatatcagtattagctgaaacaataaagaaaggaatacacgacgctgattct
gaagcgagaatagaagccaggaagtgctactggggtttccacagtcacttcagccgagaa
gcagaacacctgtaccacactttggagtcctcgtatcagaaggccctacagtcccacttg
aagaactcggacagcatcgtgtctctgccccagtcagaccgatcctcttccagctctcaa
gagagtctcaaccggccactttcagccaaaagaagtcccactggcagcactgcatccaga
ggctctacagttagtaccaaatctgtgtcgacgacaggatctctccagcgatctcgaagt
gatattgatgtgaacgcagcagccagtgccaaatccaaagtctcctcatcctcaggatcc
cccgccttcagctctgcagcagcactgcccccaggatcctatgcgtccctagacggtact
accactaaagcggagggtcggatccgcacgagacggcagagctcggggagcaccaccaat
gtcgcctccacaccctccgacagtcggggccgcagtcgcgccaaagtggtttcacagtct
cagcgatccagatctgctaaccctgctggtgctggcagccggtcaagttcccctgggaag
cttttgggaagtggacttgctgggggttcctccagaggcccaccggtaacaccatcctca
gaaaaacggagcaagatccccaggagtcagggatgtagccgagaaacaagtcctaaccgg
attggattagcacggagcagccgtatcccccgacccagcatgagtcaggggtgcagccgc
gataccagccgtgagagcagccgcgatacaagccctgctcggggcttcacaccactcgat
cggtttgggctgggccagtcaggacgaatccctggttctgtgaacgccatgagagtcttg
agtaccagcactgacctggaagcagcagtggctgacgctctgctgttaggagacgccagg
agcaagaagaagcctgtgagaaggagatacgagccctatggaatgtactctgatgatgat
gccaacagtgatgcctccagcgtgtgctctgagcgctcatatggctccaggaatggtggc
attccccattatctgcggcagactgaagatgtagcagaggttctcaaccattgtgccagt
tccaactggtcagaacggaaagaggggctcctgggcctgcagaacttactgaagagccaa
agaacactgagtcgagtagaattgaagagactgtgtgagattttcacccgaatgtttgcc
gaccctcacagcaagagagttttcagtatgtttttggagaccctcgtggattttataatc
attcataaggatgacttgcaagactggctcttcgtccttctcacacaactacttaagaaa
atgggagcagacttacttggatctgtgcaagcaaaagttcagaaggctctcgatgtcacc
agggattcctttccatttgatcaacaatttaacattttgatgagatttattgtggatcag
actcaaactccaaacctcaaggtcaaagtagcaatcctgaaatacatcgaatctctagcc
agacagatggaccccacagattttgtaaattccagcgaaacaagactagctgtttctagg
atcataacatggactacagaaccaaagagttcagacgtgagaaaggcagcacaaattgtg
ctcatctctctgtttgaactgaacacgcctgaatttaccatgttacttggtgccttgcca
aaaacattccaggatggtgccaccaaactcctgcataaccacctcaagaactccagtaac
accggtgtgggatctccaagcaatacaattggccggacaccttcccgccaccccagcagc
aggaccagccccctgacctcacccaccaactgttcccatgggggactatctccaagtcgg
ttgtggggttggagtgccgacgggctatcgaagcccccacctcccttttctcagcctaac
tccattcccaccgctccctcccacaagactctcaggcgctcttactctcccagcatgctg
gactatgatacagagaacctgaactctgaagaaatctacagctctttgcgtggagttaca
gaagccattgaaaagttcagcttccgaagccaggaggatctaaatgagccaatcaaacga
gatggcaagaaggattgtgatatcgtgtcccgagatgggggagcagcctcacctgccacc
gagggccggggaggtagtgagatagaaggaggcaggatggctttggacaacaagacctcc
ctgctcaacacgcagcctccacgtgcctttccggggccaagagcacgggaatataacccg
tatccctactccgacaccatcaacacctatgacaagacggctctgaaggaagcagtgttt
gacgatgacatggagcagctccgagatgtgcccattgaccactcagacctggtggctgac
ttgctgaaagagctatctaaccacaacgagcgtgtggaggagcggaagggcgcactgctg
gagttgctcaagatcaccagggaggacagcctgggcgtgtgggaggagcacttcaagacc
atcctgctgctgctgctggaaactctcggagacaaagaccattccattcgagctctggca
ctgagagttttacgggaaattctgagaaaccagccagcaagattcaaaaactatgcagaa
ctgacgatcatgaagactctggaagcccacaaagactcccacaaggaggtggtgagagcg
gccgaggaagctgcatccacgctagccagctcaatccacccagagcagtgcatcaaagtg
ctgtgtccaatcatccagacagccgactaccccatcaacctggctgctatcaagatgcag
acaaaggtggtggagaggatcaccaaggagtccttgctgcagctcctcgtcgacatcatc
cccggcctgctgcagggttacgacaacaccgagagcagtgtacggaaagccagtgtgttt
tgcttagtggcaatctattccgtaatcggagaagatctgaaacctcacctcgcacagctc
acggggagcaagatgaagctgctgaacttatatataaagagggcccagactaccaacagc
aacagcagctcttcctctgatgtgtccacacacagctag

DBGET integrated database retrieval system