KEGG   Mus musculus (mouse): 76719
Entry
76719             CDS       T01002                                 

Gene name
Kansl1, 1700081L11Rik, 9430041J06Rik, mKIAA1267
Definition
(RefSeq) KAT8 regulatory NSL complex subunit 1
  KO
K18400  KAT8 regulatory NSL complex subunit 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    76719 (Kansl1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     76719 (Kansl1)
SSDB
Motif
Pfam: PEHE
Other DBs
NCBI-GeneID: 76719
NCBI-ProteinID: NP_001074514
MGI: 1923969
Ensembl: ENSMUSG00000018412
Vega: OTTMUSG00000003147
UniProt: Q80TG1
Position
11; 11 E1
AA seq 1036 aa
MAAMAPALTDAAAEAHHIRFKLAPPSSTLSPGSAENNGNANILISANGTKRKAIAAEDPS
LDFRNNPTKEDLGKLQPLVASYLCSDVTSVPAKESLKLQGVFSKQTVLKSHPLLSQSYEL
RAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSSSLNGGK
RSLTSSSLQGGEVGGPDSGNLKGGMTNCTLPHRSLDIQHTTLYSNNSTANKSSVNSMDQP
ALQGSSRLSPSTDSSSNLTNVKLEVKKSPLSSILFSALDSDTRITALLRRQADIEIRARR
LQKRLQVVQAKQVERHLQHQLGGFLETTLSKLPNLESLRSRSQLMLTRKAEAALRKAASE
SATSEGLSNFLKSDSISEELERFTASGIANLRCSEQAFDSDVTDSSSGGESDIEEEELTR
ADPEQCHVPLKRRSEWRWAADRAAIVSRWNWLQAHVSDLEYRIRQQTDIYKQIRANKGLI
VLGEAPFPDHTTDLLSLSSEVKTDHGRDKLIESVSQPSENHGILVSNITESLSTKSCGAP
RPVNGVVNSLQPVLADQVPGDSSDAEEQLHKKQRLNLVSSSDGTCVAARTRPVLTCKKRR
LVRPSSIVPLSKKVHRNVRSGCDVNPSCALCGSGSVNTMPPEIHYEAPLLERLSQLDSCV
HPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKPTKKFSLKHRATMPCSLSDPVRKDRHK
LVNSFLTTAMLKHHTDMSSPSYLTATHHPPHSPLVRQLSTSSDTSTPTSSGSQVAASTSQ
PVRRRRGESSFDINNIVIPMSVAATTRVEKLQYKEILTPSWREVDVQSLKGSPDEENEEI
EDLSDAAFAALHAKCEEMERARWLWTTSVPPQRRGSRSYRSSDGRTTPQLGSANPSTPQP
ASPDVSSSHSLSEFSHGQSPRSPISPELHSAPLTPVARDSLRHLASEDTRCSTPELGLDE
QSVQPWERRTFPLAYSPQAECEEQLDAQDTAARCTRRTSGSKTGREAEVAPTSPPVVPLK
SRHLAATVTAQRPAHR
NT seq 3111 nt   +upstreamnt  +downstreamnt
atggctgcgatggcgcccgctctcactgacgcagcagctgaagcacaccacatccggttc
aaactggctcccccatcctccaccttgtcccctggcagtgccgaaaataacggcaacgcc
aatattcttatttctgccaacggaaccaaaagaaaagccattgctgcggaggatcccagt
ctagacttccgcaataatcctactaaggaagacttgggaaagctgcagccattggtggca
tcttatctctgctctgatgtaacatctgttcccgcaaaagagtctttgaaattgcaaggc
gttttcagcaagcagacagtccttaagtctcatcctcttttatctcagtcctatgaactc
cgagctgagctgctggggaggcagccagttttggagttttccttagaaaaccttagaacc
atgaatacaagtggtcagacagctctgccacaagcgcctgtaaatggattggctaagaaa
ttgactaaaagttcaacacattcggatcatgacaattccagttccctcaatgggggaaaa
cggtctctcacttcgtcatctctacaaggtggtgaggtggggggacctgactctgggaac
ttgaaggggggtatgaccaattgcactcttccacatagaagccttgatatacaacacaca
actctatatagcaataatagcactgcaaacaaatcttctgttaattccatggaccagccg
gcacttcaaggaagcagcaggttatcacctagtacagactccagctctaacttgacaaat
gtgaagttagaagtcaaaaagtctcctctgtcttccattcttttcagtgctttagactct
gatacaaggataacagctttactgaggcggcaggctgatattgagatccgtgcccgaagg
ttacagaagcgattacaggttgtgcaagccaagcaggtggagagacatttacagcaccaa
ctgggtggatttttggagacgacattgagtaaactgccaaacttggaatccttaaggtcc
cggagccagttgatgttgacccgaaaggctgaagctgccttgagaaaagctgccagtgag
tctgccacttcagagggacttagcaactttttgaaaagtgattcaatttcagaagaattg
gagagatttacagctagtggcatagccaacctgaggtgcagtgagcaagcgtttgattcg
gatgtcacagacagtagttccggaggggagtctgacattgaagaggaagaactgactcga
gctgatcctgagcaatgccatgtgcccctgaaacgtaggtctgaatggagatgggctgca
gaccgagcagctattgtcagccgctggaactggcttcaggcccatgtttctgacttggaa
tatcgaattcgtcagcaaacagatatttacaaacagatacgtgctaataaggggttgata
gtccttggggaggcacctttcccagatcatacaacagacttactttcacttagttctgag
gtgaagacagatcatgggagagataaattgattgagtctgtttctcagccatcagaaaac
catggtatccttgttagtaatattacagagtcattgtctaccaaatcatgtggagcaccg
cgacctgtcaatggagttgttaacagtcttcagcctgtcctggcagaccaagttccaggt
gacagctctgatgctgaggaacaattacataaaaagcaaaggctgaatttagtttcttca
tctgatggcacgtgtgtcgcagcccgaacccggcctgtactgacctgtaagaaacggagg
cttgttaggcccagcagcatcgttcctctttctaagaaggttcaccgtaatgtccgctct
ggctgtgatgtgaatccctcttgtgcactgtgtggttcaggcagtgtgaacaccatgcct
cctgaaatacactatgaagcacctctcttagagcgtctttcccagttggactcctgcgtt
caccctgtgctagcatttccagatgatgttcccacaagcctgcacttccagagcatgctg
aagtctcagtggcaaaacaagccttttgacaagatcaaacctaccaaaaagttttctctt
aagcacagagcgaccatgccatgcagtctgtcagatccagttcgtaaagacagacacaag
ttggtcaactccttccttacaacagccatgttgaagcatcacacagacatgagcagtccg
agctacttgacagctacccaccatccaccccacagccccctggtgagacagctctccacc
tcatcagacacctccacacccaccagctcgggctcacaagttgcagccagcacatctcag
ccagtgaggaggagaaggggagagagctcatttgatattaacaacattgtcatcccaatg
tctgttgctgcaacaactcgtgttgagaaactacaatacaaagaaatccttactccaagc
tggcgagaggttgatgttcagtctctgaaggggagtcctgatgaagagaatgaggagatc
gaggacctatctgatgcagcctttgcggccctgcatgccaaatgtgaggagatggaaagg
gcaaggtggctgtggaccacaagtgtgccaccccagcgtcggggcagcaggtcttacagg
tcatcagacggccggaccacccctcagttgggcagtgccaacccctccaccccacagcct
gcgtcccctgatgtcagtagtagccactctctgtcagaattctcccatggtcaatctcct
aggagtcccattagcccagaactacactcagcccctctcacccctgtggctcgggacagt
ctgcgacacctggccagtgaagacacccgatgttccacaccagagctgggactagatgaa
cagtcagtccagccatgggaacgacggaccttccctctggcctacagtccccaggcagaa
tgtgaggagcagctggatgcacaggacacggcagcccgctgcactcgccgcacctcaggc
agcaagactggccgggaggcagaggtggcacccacctcgcctcctgttgtcccgctcaag
agtcggcatctggcagcaacagtcacagctcagcgcccagctcacagatga

DBGET integrated database retrieval system