KEGG   Mus musculus (mouse): 76742
Entry
76742             CDS       T01002                                 

Gene name
Snx27, 5730552M22Rik, ESTM45, ESTM47, R75405
Definition
(RefSeq) sorting nexin family member 27
  KO
K17936  sorting nexin-27
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    76742 (Snx27)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    76742 (Snx27)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Others
   Others
    76742 (Snx27)
Transporters [BR:mmu02000]
 Other transporters
  Others
   76742 (Snx27)
SSDB
Motif
Pfam: PX PDZ PDZ_6 RA PDZ_2 SNX17_FERM_C USP7_C2 RBD UBX
Other DBs
NCBI-GeneID: 76742
NCBI-ProteinID: NP_001075953
MGI: 1923992
Ensembl: ENSMUSG00000028136
Vega: OTTMUSG00000019563
UniProt: Q3UHD6
Position
3; 3 F2.1
AA seq 539 aa
MADEDGEGIHPSAPHRNGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVS
EGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNGVNVEGATHKQVVDLIR
AGEKELILTVLSVPPHEADNLDPSDDSLGQSFYDYTEKQAVPISVPTYKHVEQNGEKFVV
YNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEEY
LEKVCSIRVIGESDIMQEFLSESDENYNGVSDVELRVALPDGTTVTVRVKKNSTTDQVYQ
AIAAKVGMDSTTVNYFALFEVINHSFVRKLAPNEFPHKLYVQNYTSAVPGTCLTIRKWLF
TTEEEVLLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLHEQRKMVMYLNMLRTCE
GYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLENQVIAFEWDEMQRWDTDEE
GMAFCFEYARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKENIFQMARSQQRDVAT
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggcggacgaggacggggaaggtattcacccctcagccccgcaccggaatggaggcggc
ggcggggggtctgggctccactgcgccgggaacggtggcgggggaggcggcggcccgcgg
gtcgtgcgcattgtcaagtccgaatccggctacggcttcaacgtgcggggccaagtgagc
gagggcgggcaactgcggagcatcaacggggagctgtacgcgccgctgcagcatgtgagc
gccgtgctgcccgggggggcggccgaccgggccggggtgcgcaaaggggaccgcatcctg
gaggtgaacggcgtgaatgttgagggggcgacacacaagcaggtggtggacctgatccga
gcaggcgagaaggaattgatcttgacagtgttgtctgtacctcctcatgaggctgataac
ctagatcccagtgacgactccttgggacaatcattttatgattacacagaaaagcaagca
gtgcccatatcggtccccacatacaaacatgtggagcagaatggtgagaagtttgtggta
tacaatgtttacatggctgggaggcagctgtgttctaagcggtaccgggagtttgccata
ctgcaccaaaacctgaagagagaatttgccaactttacatttcctcgacttccaggaaag
tggccattctcattatcagaacaacaattggatgcccggcgtcgtgggttggaagaatat
ctagaaaaggtgtgttcaatccgagtcattggtgagagtgacatcatgcaggaattcctg
tctgagtctgatgagaattacaatggtgtgtctgatgtagaactgagagtagcactaccg
gatggaacaacggttactgtcagagttaagaagaacagtactacagaccaagtgtaccag
gctattgcagcaaaggttggcatggacagtacaacagtgaattactttgccttatttgaa
gtgatcaatcattcctttgtacgtaagctggcacctaatgaatttcctcataaactctac
gtccagaactatacatcagctgtgccaggcacttgcctgaccattcgcaagtggctcttt
acaacagaagaagaagtcctcttaaatgacaatgaccttgctgttacgtacttctttcat
caggctgttgatgatgtaaagaaaggttacattaaagcagaagagaaatcttaccagtta
cagaagctccatgaacaaaggaagatggtcatgtacctcaacatgctaaggacctgcgag
ggctacaatgaaatcatcttccctcactgtgcctgtgactcgaggaggaagggacatgtt
atcacagccatcagcatcacgcactttaaacttcatgcatgcactgaagaagggcagctg
gagaaccaggtaatagcgtttgaatgggatgagatgcagcgatgggacacagatgaagaa
ggaatggccttctgttttgaatatgcgcgaggagagaagaagcctcgatgggttaaaatc
ttcacaccatatttcaattacatgcatgaatgctttgagagggtgttctgcgagctcaag
tggagaaaagagaatattttccagatggcgaggtcacagcagagggatgtggccacctag

DBGET integrated database retrieval system