KEGG   Mus musculus (mouse): 76775Help
Entry
76775             CDS       T01002                                 

Gene name
Slc10a7, 2410193C02Rik, P7
Definition
(RefSeq) solute carrier family 10 (sodium/bile acid cotransporter family), member 7
  KO
K14347  solute carrier family 10 (sodium/bile acid cotransporter), member 7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    76775 (Slc10a7)
   04147 Exosome [BR:mmu04147]
    76775 (Slc10a7)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC10: Sodium bile salt cotransporter
   76775 (Slc10a7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   76775 (Slc10a7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SBF_like SBF
Motif
Other DBs
NCBI-GeneID: 76775
NCBI-ProteinID: NP_084012
MGI: 1924025
Ensembl: ENSMUSG00000031684
Vega: OTTMUSG00000061289
UniProt: Q5PT53
Position
8; 8 C1
AA seq 340 aa AA seqDB search
MRLLERARKEWFMVGIVVAIGAAKLEPSVGVNGGPLKPEITVSYIAVATIFFNSGLSLKT
EELTSALVHLRLHLFIQIFTLAFFPAAIWLFLQLLSVTSINEWLLKGLQTVGCMPPPVSS
AVILTKAVGGNEAAAIFNSAFGSFLGIVVTPVLLLLFLGSSSSVPFTSIFSQLFMTVVVP
LVIGQIVRRYIKDWLERKKPPFGVVSSSVLLMIIYTTFCDTFSNPNIDLDKFSLILILFI
IVSVQLSFMLLTFIFSTRNNSGFTPADTVAIIFCSTHKSLTLGIPMLKIVFAGHEHLSLI
SVPLLIYHPAQILLGSVLVPTIKSWMVSRQKGVKLTRPTV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctggagagggcgaggaaagaatggttcatggtcgggatagtggtggcgatc
ggcgccgctaagctcgagccgtcggtcggagtgaacgggggaccactgaagccagagata
actgtgtcctacattgccgtcgcaacgatattcttcaacagtggactgtcattaaaaacg
gaggagctgaccagcgcactggtgcacctgagactgcatcttttcatccaaatcttcaca
cttgccttcttcccagcagcaatatggctctttcttcagctcttatcagtcacatccatc
aacgagtggcttttaaaaggtctgcagacagtaggttgcatgccaccccctgtgtcttct
gccgtgattttaaccaaggcagttggtggaaatgaggcagctgcgatatttaattcagca
tttggaagttttttgggcattgttgtgactccggtgctcctgctgcttttcctcggttca
tcctcttcggtgccttttacatccattttctctcagctgtttatgacggtggtggttcct
cttgtcattggacagatcgtccgacgctacatcaaggactggctggagaggaagaagcca
ccatttggtgtggtcagcagtagcgtgctactcatgatcatctacaccaccttctgtgac
accttctccaacccaaacatcgacctggacaagttcagcctcatcctcatactgttcata
atagtctccgttcagctgagcttcatgcttctgactttcatcttctccacacggaataac
tcggggttcacaccagcagacacagtggctatcatcttctgctccacacacaagtccctc
accttgggaatcccaatgctgaagatagtgtttgcaggccatgagcatctctcgctgata
tccgtgcccttgctcatctaccacccagctcagattctcctgggaagtgtgttagtgcca
acaataaagtcttggatggtgtccaggcagaagggagtgaagctgacaaggccgacagtg
tga

DBGET integrated database retrieval system