KEGG   Mus musculus (mouse): 76784
Entry
76784             CDS       T01002                                 

Gene name
Mtif2, 2310038D14Rik, 2410112O06Rik, IF-2(Mt), IF-2m, IF-2mt, IF2(mt)
Definition
(RefSeq) mitochondrial translational initiation factor 2
  KO
K02519  translation initiation factor IF-2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    76784 (Mtif2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    76784 (Mtif2)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    76784 (Mtif2)
 Prokaryotic type
   76784 (Mtif2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    76784 (Mtif2)
SSDB
Motif
Pfam: GTP_EFTU IF-2 MMR_HSR1 SRPRB FeoB_N Arf Ras RsgA_GTPase Roc GTP_EFTU_D4 PduV-EutP
Other DBs
NCBI-GeneID: 76784
NCBI-ProteinID: NP_001269047
MGI: 1924034
Ensembl: ENSMUSG00000020459
Vega: OTTMUSG00000005326
UniProt: Q91YJ5
Structure
PDB: 
2CRV

Position
11; 11 A3.3
AA seq 727 aa
MNQKLLKLENLLRFHTICRQVHSPSQRRLLAWCRHGFAPASSVWRDLLGARSWQTDMLIG
SALHQHRLLVTKKEKRPPRSQLSPVKTKKEVEVWVGMTVEDLASAMAKDIDCVYEALLNT
AIDVDSLEANSHLDEVWIKEVIKKAGMKLKWSKLKQERIRENKDAVRRPGTDPALLKPRS
PVVTVMGHVDHGKTTLLDKLRETQVAAMEVGGITQHIGAFLVSLPSGEKITFLDTPGHAA
FSAMRARGAQVTDIVVLVVAADDGVMKQTVESIQHAKDAEVPIILAINKCDKTDADPEKV
KKELLAYDVVCEEYGGDVQAVHVSALTGDNLMALAEATIALAEILELKADPTGPVEGTVI
ESFTDKGRGPVTTAIIQRGTLRKGSILVAGKSWAKVRLIFDENGKILNEAYPSMPVGIIG
WRDLPSAGDEILEVESEPRAREVIEWRKSEQKEEKGKDDLKIMEEKRREHQEAHRKAREK
YGSLHWKERSYIKFLERKQQRPLKPKEKVERQSNVLPIIIKGDVDGSVEAILNLLDTYDA
SHECELELVHFGLGDISENDVTFAETFDGVIYGFNVEAGSAIQQSAAQKGVKIKLHKIIY
HLIEDLQEELSSRLPHTLEEYPIGEASILATFTVTEGKKKIPVAGCRVQKGQLERHKKFK
LIRNGQVIWKGSLTSLKHHKDDISVIKTGMDCGLSLDEEKVEFKPGDQVICYEENKVPTK
TSWDPGF
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgaaccagaagctactgaagttggaaaacttgctacgatttcatactatttgtaggcag
gtgcacagcccaagtcaaagaagactcttagcatggtgtagacatgggtttgcaccggct
tcctcagtgtggagagatctgctgggtgcccggtcctggcagacagacatgctcattggt
tcagctttgcatcagcacagacttcttgtaacaaagaaggaaaaaagaccaccaagatct
cagttgtctccagtaaaaactaaaaaagaggtagaagtatgggttggaatgactgttgaa
gatctagccagtgccatggcaaaagatatagattgtgtatacgaagctttattgaacact
gccattgacgtagattcattagaagcaaactcacatttagatgaagtctggatcaaagaa
gttataaagaaggcaggaatgaagctgaaatggagcaaattaaaacaggaaagaattaga
gaaaataaagatgctgtgagaaggcctgggacagatccagctttattaaaaccaaggtcc
ccagttgttactgtaatgggccatgttgatcatgggaaaacgaccttacttgacaaactt
cgagaaactcaagttgcagcgatggaagtcggaggcatcactcaacacattggtgctttt
cttgtctctctgccttctggagaaaagataacttttcttgatactcctggacatgctgcc
ttctcagcaatgagagccagaggagctcaggtcaccgacattgttgtgttggttgtagct
gcagatgatggggtaatgaaacaaactgtggaatccattcagcatgcaaaagatgcagaa
gttcctattatccttgcaatcaataagtgcgacaagacagatgctgatcctgaaaaggtg
aaaaaagagctcctagcttacgatgtggtgtgtgaagagtatggtggtgatgttcaagca
gtgcacgtctctgcacttacgggcgataacctgatggctttggcagaagcaacaattgct
ctcgcagaaatcttggaactgaaagcagatcccaccggtccagtggaaggaacagtaata
gagtctttcacagacaaaggaagaggtcctgttacaacagctataattcaaagaggaact
ctgagaaaaggctcaattctagttgctgggaagagttgggcaaaagttcgactaatattt
gatgaaaatggaaaaatacttaatgaggcctatcccagcatgccagtgggaatcataggc
tggagagaccttccttctgcaggagatgaaattcttgaagtagaatctgagccaagggcc
cgtgaagttattgaatggaggaagtctgagcaaaaagaagaaaaaggcaaagatgacctg
aaaataatggaagaaaagcgaagggaacaccaagaagcgcatcggaaagcccgtgagaag
tatggcagtctgcactggaaagagagatcatatataaagttccttgaaaggaaacaacag
agacccttaaagcccaaagaaaaggtagaaaggcaatcaaatgtacttcctataattatt
aaaggtgacgttgatgggtctgtggaggccatcttgaaccttctggatacctacgatgct
tcccacgaatgtgaactcgaattagtacattttggattgggtgacatcagtgaaaatgat
gttacctttgctgagacatttgatggtgttatttatggttttaatgtggaggcaggcagt
gctattcagcagtcagctgcacaaaagggagttaagattaaacttcacaaaatcatctac
catcttattgaagatttgcaggaggaactaagcagcagattgccccacacactggaggag
tacccaataggtgaggcttctatactagctaccttcactgtaacagaagggaagaaaaaa
attcctgttgctggctgcagagttcaaaagggacaattagaaagacataagaagtttaaa
ttaatccgaaacggccaagttatttggaagggatcattaacctctctgaaacaccataaa
gatgacatttcagttataaaaactggtatggactgtggtcttagtttagatgaagaaaaa
gtcgaattcaaaccgggagatcaagtcatttgttatgaagaaaataaagttccaactaag
acttcctgggatccaggattttaa

DBGET integrated database retrieval system