KEGG   Mus musculus (mouse): 76809
Entry
76809             CDS       T01002                                 

Symbol
Bri3bp, 2410150I18Rik, AI841257, AW742481
Name
(RefSeq) Bri3 binding protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: BRI3BP CLZ
Other DBs
NCBI-GeneID: 76809
NCBI-ProteinID: NP_084028
MGI: 1924059
Ensembl: ENSMUSG00000037905
Vega: OTTMUSG00000055093
UniProt: Q8BXV2
Position
5; 5 G1.1
AA seq 253 aa
MGARASQEPRTRVRAGLRVLLPVLLLALLLLALVAPGAQGARGRGAADKNSHRRATSSFS
QSVSSLFGEDNVRAAQKLLSRLTERFVQGVDMFLETLWKVWMELLEVLGLDVSNLSQYFS
PASVSNSPTRALVLVGVVLLAYWFLSLTLGFTFSLLHLVFGRFFWLVRVILFSMSCVYIL
HKYEGEPEHAVLPLCVVVAIYFMTGPMGYWRGSPGGLCSPSVEEKLEHLENQVRLLNIRL
NRVLENLDRSKDK
NT seq 762 nt   +upstreamnt  +downstreamnt
atgggcgcgcgcgcgtcccaggagccccggacccgggtccgggccgggttgcgggtgctg
ctgccggttctgcttctggcgctgctgctgctggcgctggtggctcctggagcgcagggg
gctcggggccgcggggctgcggacaagaacagccaccggcgcgcgacgagcagcttctcg
cagagcgtgagcagcctcttcggagaggacaacgtgcgcgcggctcagaagttactgtcc
aggctgaccgagcggttcgtgcagggagtggacatgttcttagagacgttatggaaagtt
tggatggagctcttagaagtccttgggcttgacgtgtccaacctgtcacagtacttcagc
ccagcctcagtgtccaacagccccacccgggccctggtgctggttggtgtggttctcctg
gcctactggttcttgtctctgaccttgggcttcaccttcagcctcctccacctggtgttt
ggccgcttcttctggctcgtgcgtgtcatcctgttctccatgtcctgcgtgtatatccta
cataagtacgagggcgagccagagcacgcagtgctaccgctctgcgtcgtggtggccatc
tacttcatgacggggcccatgggctactggcggggcagccccggtggcctttgcagcccc
agtgtggaggagaagctggaacacctggagaaccaggtgaggttgcttaacatccgcctc
aacagggtgctcgagaaccttgaccgctccaaggacaagtga

DBGET integrated database retrieval system