KEGG   Mus musculus (mouse): 76813Help
Entry
76813             CDS       T01002                                 

Gene name
Armc6, 2410153K17Rik, AW554412
Definition
(RefSeq) armadillo repeat containing 6
  KO
K24166   
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Arm DUF3361 Mis14 UBA_3
Motif
Other DBs
NCBI-GeneID: 76813
NCBI-ProteinID: NP_598733
MGI: 1924063
Ensembl: ENSMUSG00000002343
Vega: OTTMUSG00000022201
UniProt: Q8BNU0
Position
8; 8 B3.3
AA seq 468 aa AA seqDB search
MASKRITQETFDAAVRENIEEFEMGTEEAIREAVEQFESQGVDLSNIVKTIPKVSLDGLQ
EPTHSVLQALNDLQESLTGSRLQEVSAHLVRFCDQCKQQKASRYLAAQKGAYPILLAAWQ
LAATSNQGLLLQALNALAVLTDGQPDLLDAQGLHLLVATLAQNAANTELTCCGIRCVRHV
CLKHEQNRQDLVKAGVLPLLTAAITQHGQHADVVREACWALRVMTFDDDIRVPFGHAHEH
AKMIVQENKGLKVLIEAARAFSDNPGVLSELCSTLSRLAVRNEFCQEVIDLGGLGILVTL
LADCNDHQDLVKQVLSALRAIAGNDDVKDAIVRAGGTESIVAAMTRHLASPQVCEQSCAA
LCVLALRKPDNSRVIIEGGGALAALQAMKAHPQEAGVQKQACMLIRNLVSRSQVFSKPIL
DLGAEELILQARAAHPDCEDVAKAALRDLGCRVELRELWTGKKGDLAL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaagcgcatcacccaggaaacctttgatgctgcagtgcgggagaacattgag
gagtttgagatgggcactgaggaggccattcgagaggctgtggagcagtttgaatcacaa
ggggttgatctgagcaacattgtgaagacaataccgaaagtatcactggatggccttcag
gagcccacacatagtgtccttcaggcccttaacgatctgcaggagtccctgactggctct
cggctccaggaggtgtcagcccaccttgtccgcttctgtgaccagtgcaagcagcagaag
gccagccgctacctggcagcccagaagggagcctacccaatcctcctggctgcctggcag
ctggctgccactagcaaccagggtcttctgctccaggctctcaatgctctggcagtgctg
actgatggccagcctgacctcctggatgcccagggcttgcatcttctcgtggccacgcta
gcacagaatgccgccaacactgaactcacgtgctgtgggattcgctgcgtgcgccatgtc
tgcctaaagcacgaacagaatcggcaggacttggtgaaagctggcgtgttgcccctgctc
acagcggctattacacagcatggccagcacgccgatgtggtcagggaggcctgctgggcc
ttgcgggtcatgacctttgatgatgatatccgagtgccctttggccatgcccatgagcac
gccaagatgattgttcaggagaacaaaggcctgaaggtgctcattgaggctgccagagca
ttctctgacaacccaggggtcctgagcgaactctgcagcaccctatcccgcctggctgtt
cggaatgaattctgccaggaggttatagacctcggaggccttggcatccttgtgaccctg
ctggctgactgcaatgaccaccaggacctcgtgaagcaagttctcagtgccctgagggct
atcgcaggcaacgacgacgtaaaggatgccattgtccgggcaggtggtacggagtccatt
gtggctgctatgactcggcacctggccagcccccaggtgtgtgagcaaagctgcgccgca
ctctgcgtcctagctcttcgcaagccagacaacagccgggtcattattgagggcggcggg
gcgctggctgctctgcaggccatgaaggcgcatccacaggaggctggtgtccagaaacag
gcttgcatgctgatccgaaacctggtgtcccgcagccaagtcttctccaagcccatcctg
gacctgggggcagaggagctcattttgcaagcccgagctgctcacccagactgtgaagat
gtggctaaggccgcattgcgagacctaggctgccgtgtggagcttcgtgaactgtggaca
ggaaagaagggtgacctggctctatga

DBGET integrated database retrieval system