KEGG   Mus musculus (mouse): 76813
Entry
76813             CDS       T01002                                 

Symbol
Armc6, 2410153K17Rik, AW554412
Name
(RefSeq) armadillo repeat containing 6
  KO
K24166  armadillo repeat-containing protein 6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    76813 (Armc6)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  Armadillo repeat domain-containing proteins
   76813 (Armc6)
SSDB
Motif
Pfam: Arm ELMO_ARM Mis14 UBA_3
Other DBs
NCBI-GeneID: 76813
NCBI-ProteinID: NP_598733
MGI: 1924063
Ensembl: ENSMUSG00000002343
Vega: OTTMUSG00000022201
UniProt: Q8BNU0
Position
8:complement(70672822..70687099)
AA seq 468 aa
MASKRITQETFDAAVRENIEEFEMGTEEAIREAVEQFESQGVDLSNIVKTIPKVSLDGLQ
EPTHSVLQALNDLQESLTGSRLQEVSAHLVRFCDQCKQQKASRYLAAQKGAYPILLAAWQ
LAATSNQGLLLQALNALAVLTDGQPDLLDAQGLHLLVATLAQNAANTELTCCGIRCVRHV
CLKHEQNRQDLVKAGVLPLLTAAITQHGQHADVVREACWALRVMTFDDDIRVPFGHAHEH
AKMIVQENKGLKVLIEAARAFSDNPGVLSELCSTLSRLAVRNEFCQEVIDLGGLGILVTL
LADCNDHQDLVKQVLSALRAIAGNDDVKDAIVRAGGTESIVAAMTRHLASPQVCEQSCAA
LCVLALRKPDNSRVIIEGGGALAALQAMKAHPQEAGVQKQACMLIRNLVSRSQVFSKPIL
DLGAEELILQARAAHPDCEDVAKAALRDLGCRVELRELWTGKKGDLAL
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggcttccaagcgcatcacccaggaaacctttgatgctgcagtgcgggagaacattgag
gagtttgagatgggcactgaggaggccattcgagaggctgtggagcagtttgaatcacaa
ggggttgatctgagcaacattgtgaagacaataccgaaagtatcactggatggccttcag
gagcccacacatagtgtccttcaggcccttaacgatctgcaggagtccctgactggctct
cggctccaggaggtgtcagcccaccttgtccgcttctgtgaccagtgcaagcagcagaag
gccagccgctacctggcagcccagaagggagcctacccaatcctcctggctgcctggcag
ctggctgccactagcaaccagggtcttctgctccaggctctcaatgctctggcagtgctg
actgatggccagcctgacctcctggatgcccagggcttgcatcttctcgtggccacgcta
gcacagaatgccgccaacactgaactcacgtgctgtgggattcgctgcgtgcgccatgtc
tgcctaaagcacgaacagaatcggcaggacttggtgaaagctggcgtgttgcccctgctc
acagcggctattacacagcatggccagcacgccgatgtggtcagggaggcctgctgggcc
ttgcgggtcatgacctttgatgatgatatccgagtgccctttggccatgcccatgagcac
gccaagatgattgttcaggagaacaaaggcctgaaggtgctcattgaggctgccagagca
ttctctgacaacccaggggtcctgagcgaactctgcagcaccctatcccgcctggctgtt
cggaatgaattctgccaggaggttatagacctcggaggccttggcatccttgtgaccctg
ctggctgactgcaatgaccaccaggacctcgtgaagcaagttctcagtgccctgagggct
atcgcaggcaacgacgacgtaaaggatgccattgtccgggcaggtggtacggagtccatt
gtggctgctatgactcggcacctggccagcccccaggtgtgtgagcaaagctgcgccgca
ctctgcgtcctagctcttcgcaagccagacaacagccgggtcattattgagggcggcggg
gcgctggctgctctgcaggccatgaaggcgcatccacaggaggctggtgtccagaaacag
gcttgcatgctgatccgaaacctggtgtcccgcagccaagtcttctccaagcccatcctg
gacctgggggcagaggagctcattttgcaagcccgagctgctcacccagactgtgaagat
gtggctaaggccgcattgcgagacctaggctgccgtgtggagcttcgtgaactgtggaca
ggaaagaagggtgacctggctctatga

DBGET integrated database retrieval system