KEGG   Mus musculus (mouse): 76856Help
Entry
76856             CDS       T01002                                 

Gene name
Catsper3, 4921522D01Rik, CACRC
Definition
(RefSeq) cation channel, sperm associated 3
  KO
K16891  cation channel sperm-associated protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    76856 (Catsper3)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, sperm-associated (CatSper)
   76856 (Catsper3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel Ribosomal_S24e
Motif
Other DBs
NCBI-GeneID: 76856
NCBI-ProteinID: NP_001239416
MGI: 1924106
Ensembl: ENSMUSG00000021499
Vega: OTTMUSG00000027746
UniProt: Q80W99 E0Z0E0
Position
13; 13 B1
AA seq 395 aa AA seqDB search
MSQHFHHNPVRVKSGSLFATASEALQARLSKIKRKDKECQAYFRKVIKSTFFQIVMITTV
TTNSFLLVLGTNYDIQFEFFRTFEVSELFFVSVYVCEFLMKVYVDPITYWKDGYNILDVI
ILIILTIPYLLRKIKGNHSAYLHFADGIQSLRILKLISYSRGIRTLIIAVGETVYTVASV
LTLLFLLMFVFAILGFCLFGVTDRGDLENWGNLASAFFTLFSLATVDGWTDLQEELDKRK
FTVSRAFTILFILLASFIFLNMFVGVMIMHTEDSMKKFERDLTLERNLAIMEEKQIILKR
QQEEVNRLMNTQKSGSMNFIDMVEGFKKTLRHTDPMVLDDFSTSLSFIDIYLVTLDNQDV
IVSKLQELYCEIVNVLSLMLEDMPKESSSSLSGLS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaacattttcaccacaaccctgtacgagtcaagtcgggctcactgtttgctaca
gcatcggaagcattgcaggcaagactgagcaagattaagaggaaggataaggagtgccag
gcttacttcaggaaggttattaagagcactttcttccagattgtgatgatcaccacggtc
accaccaactcctttttactggtcttggggactaattatgacatacaattcgagtttttc
agaacctttgaggtctcagagcttttctttgtatctgtctatgtctgcgagttcctcatg
aaggtctatgtggaccccattacatactggaaggatggctataacatactggatgtgatc
attctcatcattctcaccataccctatctcctccgcaaaatcaaggggaatcattctgca
tacctccactttgctgatggcatccagtctctacgaatcctcaagcttatctcctacagt
aggggcatcaggacactcatcatcgctgtgggggagacggtctacactgtggcctcggtg
ctgacgctgctcttcctcctcatgtttgtgttcgcgatcctgggattctgcctatttggc
gtgacggacagaggcgacctggagaactgggggaacctggcttcagctttctttactctc
ttcagtttggccacggttgatggctggactgacctgcaggaagagctggacaagaggaag
tttactgtgagccgggcgtttactatcctcttcatcttgcttgcatccttcatcttcctc
aacatgtttgtgggtgtgatgatcatgcacacggaggattccatgaaaaagtttgagcgg
gatctgacgttggagaggaaccttgcgattatggaggagaagcaaataatcctgaaacgc
cagcaagaggaggtcaacaggctgatgaacacacagaaaagtggtagcatgaacttcatt
gatatggtggagggcttcaagaagaccctgcggcacacagaccccatggttctggatgac
ttcagcactagtctctccttcattgatatctacttggtcactctggacaaccaagatgtt
attgtcagcaagcttcaggagctctactgtgagattgtgaacgtgctgagcctgatgttg
gaagacatgcccaaggagagctcgtccagcctctcgggactaagttag

DBGET integrated database retrieval system