KEGG   Mus musculus (mouse): 76857
Entry
76857             CDS       T01002                                 

Gene name
Spopl, 4921517N04Rik, AU014935, BB233739, E430033K04Rik
Definition
(RefSeq) speckle-type BTB/POZ protein-like
  KO
K10523  speckle-type POZ protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    76857 (Spopl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    76857 (Spopl)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     76857 (Spopl)
SSDB
Motif
Pfam: BTB MATH
Other DBs
NCBI-GeneID: 76857
NCBI-ProteinID: NP_084049
MGI: 1924107
Ensembl: ENSMUSG00000026771
Vega: OTTMUSG00000011465
UniProt: Q2M2N2
Position
2; 2 A3
AA seq 392 aa
MSREPTPPLPGDMSTSPVAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSG
PNDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNDKREETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNVSGHTSTNTLK
VPECRLAEDLGNLWENTRFTDCCFFVRGKEFKAHKSVLAARSPVFNAMFEHEMEECTKNR
VEINDLDPEVFKEMMRFVYTGKAPNLDKMADNLLAAADKYALERLKVMCEEALCSNLSVE
NVADTLVLADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNNNQATDIMETSGWKSMI
QSHPHLVAEAFRALASSQCPQFGIPRKRLKQS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtctcgggaacctactccacctctgcctggagatatgtctactagtcctgttgcagaa
agctggtgttacacacaggttaaagtagtgaaattttcctacatgtggactattaataac
ttcagtttttgtagagaagaaatgggtgaagtgttaaagagttcaacgttttcttcaggc
ccaaatgataaaatgaaatggtgcctgagggtaaacccaaagggattagatgacgaaagt
aaagactatttgtccttatatttgctcctagtcagctgcccaaaaagtgaggttcgagct
aaattcaaattctctcttctcaatgataaaagggaagaaacaaaagcaatggaaagccaa
agagcatatcgatttgtacaggggaaggactggggatttaaaaaattcattagaagggat
tttttgcttgatgaagctaatggtctccttccagatgacaagcttacgttattctgtgag
gtgagtgtggtccaagattcagtaaatgtatcaggacacactagtacaaacactttgaag
gtgccagaatgtcgactagcagaagatttaggtaatctctgggaaaacacaagatttaca
gattgctgcttttttgtgagaggaaaagaattcaaagctcataagtctgtgcttgcagct
cgatccccagtttttaatgcaatgtttgaacatgaaatggaagaatgcacaaagaatcga
gtggaaataaatgatttagaccctgaggtatttaaagaaatgatgagatttgtttacaca
ggaaaagcaccaaatcttgataaaatggctgacaacttgttggcagctgcagacaaatat
gcactggaacggctgaaggtcatgtgtgaagaagctttgtgtagtaacctctcagtagaa
aatgttgctgatacccttgtccttgcagatttgcacagtgcagaacagttgaaagcccag
gcaatagactttattaataggtgcagtgttcttcgacaacttgggtgtaaggatgggaaa
aactggaacaacaaccaagcaactgacataatggaaacatcggggtggaagtccatgatt
cagtctcatccccatttagtggcagaagcgttccgagcactagcatcttcacagtgtcca
cagtttggtattccacgcaaaaggttaaagcagtcttga

DBGET integrated database retrieval system