KEGG   Mus musculus (mouse): 76884
Entry
76884             CDS       T01002                                 

Gene name
Cyfip2, 1500004I01Rik, 6430511D02Rik, AA930218, AU022376, Pir121, mKIAA1168
Definition
(RefSeq) cytoplasmic FMR1 interacting protein 2
  KO
K05749  cytoplasmic FMR1 interacting protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu04810  Regulation of actin cytoskeleton
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    76884 (Cyfip2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    76884 (Cyfip2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    76884 (Cyfip2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    76884 (Cyfip2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     76884 (Cyfip2)
   Factors involved in mRNA localization
    Other mRNA localization factors
     76884 (Cyfip2)
SSDB
Motif
Pfam: FragX_IP DUF1394 zf-CW
Other DBs
NCBI-GeneID: 76884
NCBI-ProteinID: NP_001239388
MGI: 1924134
Ensembl: ENSMUSG00000020340
Vega: OTTMUSG00000005492
UniProt: Q5SQX6
Position
11; 11 B1.1
AA seq 1253 aa
MTTHVTLEDALSNVDLLEELPLPDQQPCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYI
EQATVHSSMNEMLEEGHDYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVT
KLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLAD
IVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFK
QLQVVPLFGDMQIELARYIKTSAHYEENKSKWTCTQSSISPQYNICEQMVQIRDDHIRFI
SELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTD
KFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIY
AALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREPPNDPCLRGEKDPKG
GFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLDGPIVLAIEDFHKQSFF
FTHLLNISEALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMM
EYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKAMAGSV
LLDKRFRAECKNYGVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLD
QAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSFDAMFREANHNVSAPYGRITL
HVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHI
YSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICR
LPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCD
LLHAAPFQNILPRVYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLL
TKERLCCGLSMFEVILTRIRSYLQDPIWRGPPPTNGVMHVDECVEFHRLWSAMQFVYCIP
VGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPL
KKMADRIRKYQILNNEVFAILNKYMKSVETDSSTVEHVRCFQPPIHQSLATTC
NT seq 3762 nt   +upstreamnt  +downstreamnt
atgaccacccacgtcactttggaagatgccctgtccaacgtggacctgctggaggaactg
cccctcccagaccagcagccatgtatcgagcccccgccatcctccatcatgtaccaggct
aactttgacacgaacttcgaggacaggaatgcatttgtcacgggcattgcaaggtacatt
gagcaggcaacggtccactccagcatgaatgaaatgctggaggagggccacgactatgca
gtcatgctgtacacctggcgcagctgctcccgggccatcccgcaggtgaagtgcaatgag
cagcccaatcgggtcgagatctacgagaagacggtggaggtgctggagccagaggtcacc
aagctcatgaagttcatgtactttcagcgcaaggccatcgagcgcttctgtagcgaggtg
aagcggctgtgtcacgctgagcgcaggaaggactttgtctctgaggcctacctgctgacg
ctgggcaagttcatcaacatgttcgcggtcttggacgagctaaagaacatgaagtgcagt
gtcaagaatgaccactctgcctacaagagagcagcacagttcctaaggaagatggcggac
ccccagtccatccaggaatctcagaacctgtccatgttcctggccaatcacaacaggatc
acccagtgtcttcaccagcaactggaagtgatcccgggctatgaggagctgctggcagac
attgtcaacatctgtgttgattactatgagaataagatgtacctgacgcccagtgaaaag
cacatgttgctcaaggtgatgggctttggtctctatctgatggacggaaatgtcagtaac
atttacaaactggatgccaagaagagaatcaaccttagcaaaattgataagttttttaag
cagctgcaggtggtaccccttttcggcgacatgcagatagagctggccagatacattaag
accagtgctcactatgaagagaacaagtccaagtggacatgcactcagagcagcatcagc
ccccagtacaacatctgtgagcagatggttcagatccgggatgatcacatccgcttcatc
tctgagctggctcgctacagcaacagcgaggtggtgacaggctcagggctggacagccag
aagtcggatgaagagtaccgggagctttttgacctggccctgcgaggcctgcagcttcta
tccaagtggagtgcccatgtcatggaggtgtactcttggaagctggttcaccccacagac
aagttctgcaacaaggactgcccgggcaccgcggaagagtacgagagagccacgcgctac
aattataccagcgaggagaagtttgcctttgtggaggtgattgccatgatcaagggtttg
caggtgctcatgggaaggatggagagtgtcttcaaccaggccatccgcaacactatctac
gcagccctgcaggatttcgcccaggtgacgctgcgggagccgttgcggcaagcagttcga
aagaaaaagaatgtccttatcagcgttctgcaagcaattcgaaagaccatctgtgactgg
gagggaggccgagagccccccaatgacccatgcttaagaggggagaaggaccccaaaggt
ggctttgacatcaaggtgccccgccgtgctgtgggtccatccagcacacagctgtacatg
gtgcgcaccatgcttgagtcactcatcgcagacaagagcggctccaagaagacgctcaga
agcagcctggatggccctatcgtccttgccatagaggacttccacaagcagtccttcttt
ttcacacacctgcttaacatcagcgaggctcttcagcagtgctgtgacctctcccagctc
tggttccgagaattcttcctggagttgaccatgggccggcgaatccagttcccgattgag
atgtccatgccctggattctaacggaccatattctggaaaccaaagaaccttccatgatg
gagtatgtcctctaccccttggatctgtacaacgacagcgcctactatgccctcaccaaa
ttcaaaaagcagttcctgtatgacgagatcgaagccgaggtaaacctgtgttttgatcag
tttgtctacaagctggctgaccagatcttcgcctactacaaagccatggccggcagtgtc
ctgctggataaacgttttagagctgagtgtaagaactatggggtgatcataccgtacccg
ccatccaaccgctacgagacactgctgaagcagagacatgtccagctgttggggagatca
attgacttgaacagactcatcacccagcggatctctgctgccatgtacaagtccttggac
caggccatcagccgctttgagagtgaagacctgacctccattgtggagctggagtggctg
ctggagattaaccgactcacacaccgactcctctgtaagcacatgacgctagacagcttc
gatgccatgttccgagaagccaatcataacgtgtctgccccttacggccgcatcaccctg
catgtcttctgggagctgaactttgactttctccccaactactgctataatggatccaca
aaccgttttgtccgaactgccatccctttcacccaagaaccacaacgggataagcccgcc
aatgtccagccttattacctctatggatccaagcctctcaacattgcctacagccacatc
tatagctcctaccggaactttgtggggccccctcacttcaagaccatctgcagactgttg
ggctaccagggcatcgctgtggtcatggaggaactgctgaaaatcgtcaagagcttgctc
caaggcaccatcctgcagtacgtgaagacgctcatagaggtgatgccgaaaatctgtcgt
ttgcctcggcacgagtacggctctccaggaatcctggagttcttccaccaccaactgaag
gacatcatcgagtatgcagaactcaaaacagacgtgttccagagcctccgagaggtgggc
aacgccatcctgttctgcctcctcatagagcaagctctgtctcaggaggaagtctgtgat
ttgctccatgctgcacccttccaaaacattctgccccgagtctacatcaaagagggggag
cgcctggaagtccggatgaagcgcctcgaggccaagtacgccccacttcacctggttccc
ctgatagagcggctggggacgcctcagcaaatcgccatcgctcgggagggtgacctgctg
accaaggagcggctctgctgcggcctgtccatgtttgaggtcatcctgacccgaatccgg
agctacctgcaggaccccatctggaggggcccgccacccaccaatggcgtcatgcatgtg
gatgagtgtgtggagtttcaccggctgtggagtgccatgcagtttgtctactgtatccct
gtggggaccaacgagttcacagctgagcagtgcttcggtgacggcttgaactgggccggc
tgctccatcattgtcttgctgggccagcagcggcgctttgacctgtttgacttctgttat
catctgctgaaggtgcagaggcaggacgggaaggatgagatcattaagaatgtgcctctg
aagaagatggctgaccgcatcaggaagtaccagatcttgaacaatgaggtttttgccatc
ctgaacaagtacatgaagtctgtagagacagacagttccaccgtagagcatgtgcgctgc
ttccagcccccaatccaccagtcattggccaccacctgctag

DBGET integrated database retrieval system