KEGG   Mus musculus (mouse): 76889
Entry
76889             CDS       T01002                                 

Symbol
Coq8b, 0610012P18Rik, Adck4
Name
(RefSeq) coenzyme Q8B
  KO
K08869  aarF domain-containing kinase
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    76889 (Coq8b)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  ABC1 family
   76889 (Coq8b)
SSDB
Motif
Pfam: ABC1
Other DBs
NCBI-GeneID: 76889
NCBI-ProteinID: NP_598531
MGI: 1924139
Ensembl: ENSMUSG00000003762
Vega: OTTMUSG00000023773
UniProt: E9QLB8
Position
7:26928112..26957374
AA seq 533 aa
MWLELGAMLRRTCGPLGRAVRLPCGGALGPRPHWWGPCRSCLAQSVHQDQPGRGLSEDDI
RRAREARLRKAPRPQLSDRSRERKVPASRISRLASFGGLAVGLGLGALAEVTKKSLPGGS
LQHEGVSGLGSSPFLSEANAERIVQTLCTVRGAALKIGQMLSIQDNSFISPQLQRIFERV
RQSADFMPRWQMMRVLEEELGKDWQDKVASLEEVPFAAASIGQVHQGLLKDGTEVAVKIQ
YPGVAQSIQSDVENLLALLKMSVGLPEGLFAEQSLQTLQQELAWECDYCREAACAQTFRK
LLADDPFFRVPAVVQELCTTRVLGMELAGGIPLDQCQGLSQDIRNQICFQLLRLCLRELF
EFRFMQTDPNWANFLYDASSHQVTLLDFGASRAFGTEFTDHYIEVVKAAADGDRDRVLQK
SQDLKFLTGFETKAFSDAHVEAVMILGEPFAASGPYDFGAGETARRIQGLIPVLLRHRLR
PPPEETYALHRKLAGAFLACARLHAHIACRDLFQDTYHRYWASRQTLPLPAAS
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgtggctggagctaggtgccatgctgcgcaggacctgtggaccgctgggcagggctgtt
cgtctgccctgtgggggggccctaggacctaggccccactggtgggggccatgtaggagt
tgcttggcccaaagtgttcatcaagaccagcctggaagaggcctcagtgaagatgacatt
cgcagggcacgggaggcccggctcaggaaggcaccccggccccagctgagtgatcgctct
cgtgaacgcaaggtgcctgcctcccgcatcagtcgcttggccagctttggggggctggct
gtgggcttgggcctgggagcgctggctgaggtgactaagaagtccttgccaggtggaagt
ctgcagcatgagggcgtctctggattgggctccagtcctttcctctccgaggccaatgct
gagaggatcgtgcagaccttatgtacagtccggggggctgccctcaagatcggccaaatg
ctcagtatccaggacaacagctttatcagcccccagcttcagcgaatctttgagagggtc
cgacagagtgccgactttatgccccgctggcaaatgatgagagttctagaagaggagcta
ggcaaggactggcaagacaaggtggcctccctcgaggaagtgccctttgctgctgcctcc
attgggcaggtacaccaaggcttgctaaaggatgggactgaggtggctgtgaagatccag
tacccaggtgttgcccagagcatccagagtgacgtggagaacctgctggccctgctcaag
atgagtgtgggcctgccagagggcctgtttgctgagcagagcctgcagaccttgcagcag
gagctggcttgggaatgtgactactgcagagaagcggcctgtgcccagaccttcaggaag
ctcttagctgacgaccccttcttccgagtgccagctgtggtgcaggagctatgcactaca
cgggtgctgggcatggagctggctgggggaatccctctagaccagtgccagggcctgagc
caagacatccggaatcagatctgctttcagctcctgaggttgtgtctgcgggaactgttt
gagttcagattcatgcagactgatcccaactgggccaacttcctgtatgatgcctccagc
caccaggtgactctactggattttggtgcaagccgggcgtttgggacagagttcacggac
cattacattgaggtggtgaaggctgcagcagatggagacagagatcgagttctacagaaa
tcccaggacctcaagttccttacaggctttgaaaccaaggcattctctgacgcccacgtc
gaggcagtgatgatcctgggggagccctttgctgcctcaggcccctacgactttggggct
ggagagactgctcgccgaatacagggcctcatcccggtattgcttcggcaccggctgcgc
ccaccgcctgaggagacctatgctctacaccgcaagctagctggggctttcttagcctgt
gcccgtctccacgcccacatcgcctgccgggacctcttccaagatacctaccaccgctac
tgggccagtcgccagacactgccgctgccagcagcctcctga

DBGET integrated database retrieval system