KEGG   Mus musculus (mouse): 76890
Entry
76890             CDS       T01002                                 

Gene name
Memo1, 0610016J10Rik, D930048L02Rik
Definition
(RefSeq) mediator of cell motility 1
  KO
K06990  MEMO1 family protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    76890 (Memo1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     76890 (Memo1)
SSDB
Motif
Pfam: Memo
Other DBs
NCBI-GeneID: 76890
NCBI-ProteinID: NP_598532
MGI: 1924140
Ensembl: ENSMUSG00000058704
UniProt: Q91VH6
Position
17; 17 E2
AA seq 297 aa
MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAA
HAYKQVDPSVTRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFE
RMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADP
SNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYH
NTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRSWQDSSVSYAAGALTVH
NT seq 894 nt   +upstreamnt  +downstreamnt
atgtccaaccgagtggtctgccgggaagccagccacgccgggagctggtacaccgcctca
ggacctcagctgaacgctcagctggaaggttggctttcacaagtacagtctacgaaaaga
cctgctagagccattattgcaccccatgcgggatacacatactgtgggtcctgtgctgcc
catgcttacaaacaagtggatccatctgttacccggagaattttcatccttgggccttcc
catcatgtgcccctgtctcgatgtgcactctccagtgtggatatatataggactcctctg
tatgatcttcgtattgaccaaaagatttacggagagctatggaagacaggaatgtttgaa
cgaatgtctctgcagacagatgaagatgaacacagtattgaaatgcatttgccttataca
gctaaagccatggaaagccataaagatgagtttaccattattcctgtactggttggagct
ctgagtgagtcaaaagaacaggaattcggaaaactcttcagtaaatatctagcggatcct
agtaatctctttgtggtttcttctgatttctgccactggggtcaaaggttccgttacagt
tactatgatgaatcccagggggagatttatagatccattgaacatctagataaaatgggt
atgagtattatagaacaattagatcctgtatcttttagcaattatttgaagaaatatcat
aatactatatgtggaagacatcccattggggtgttattaaatgctatcacagagcttcag
aagaatggaatgaatatgagcttttcctttttgaattatgcccagtcgagccagtgtaga
agctggcaagacagttcagtcagttacgcagctggagcactcacggtccactga

DBGET integrated database retrieval system