KEGG   Mus musculus (house mouse): 76892
Entry
76892             CDS       T01002                                 
Symbol
Rnft1, 0610013E23Rik, AV007605
Name
(RefSeq) ring finger protein, transmembrane 1
  KO
K22379  E3 ubiquitin-protein ligase RNFT1 [EC:2.3.2.27]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    76892 (Rnft1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     76892 (Rnft1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    76892 (Rnft1)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_5 zf-RING_UBOX zf-rbx1 Prok-RING_4 zf-C3HC4_4 zf-RING_6 zf-ANAPC11 zf-P11
Other DBs
NCBI-GeneID: 76892
NCBI-ProteinID: NP_084064
MGI: 1924142
Ensembl: ENSMUSG00000020521
UniProt: Q9DCN7
Position
11:86375483..86389833
AA seq 395 aa
MQASCNQLHDPPGTAHEDAAASPCGHSRSTEGSLHPGDVHIQINSGPKEYSENPSSRNPR
SGVCTCAHGCVHGRFRSYSHSEARPPDDFATESGEHGSGSFSEFRYLFKWLQKSLPYILI
LGIKLVMQHITGISLGIGLLTTFMYANKSIVNQVFLRERSSKLRCAWLLVFLAGSSVLLY
YTFHSQSLHYSLIFLNPTLEQLSFWEVLWIVGITDFILKFFFMGLKCLILLVPSFIMPFK
SKGYWYMLLEELCQYYRIFVPIPVWFRYLISYGEFGNVTTWSLGILLALLYLILKLLDFF
GHLRTFRQVLRVFFTRPSYGVPASKRQCSDMDGICTICQAEFQKPVLLFCQHIFCEECIT
LWFNREKTCPLCRTVISECINKWKDGATSSHLQMY
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgcaagccagctgtaaccaactgcatgatcctccgggcactgcacatgaagatgctgca
gcctccccgtgtggtcattcaagatcaacagaaggttcccttcaccctggggatgtacat
atccaaataaactccggaccaaaagaatattctgaaaatccaagctctagaaatcccagg
tcaggcgtctgtacttgtgcccatggatgtgtgcatggtcgtttccggagttactcccac
agtgaagcaagaccacctgatgactttgctacagagtctggggaacatggaagtggctcc
ttctcagaattccgctatctcttcaagtggttgcaaaaaagtcttccttatattttaatt
ctgggtattaaacttgttatgcagcatataacaggaatttctcttggaattgggctgcta
acaacttttatgtatgcaaacaaaagcattgtaaatcaggtttttctaagagaacggtca
tcaaagctccgctgtgcttggttactggtgttcctggcaggttcctccgtcctcttatat
tacacttttcattctcagtcacttcattacagcttaattttcttaaatcctacactcgaa
cagttgagcttctgggaagttctttggattgttggaattacagacttcattctgaaattc
tttttcatgggtttaaaatgcctgattttattggtgccttctttcatcatgccttttaaa
tcaaagggatattggtacatgcttttagaagaattgtgtcagtattaccgaatttttgtt
cctataccagtttggtttcggtaccttataagctacggggagtttggtaatgtaactaca
tggagtcttgggatattgctggctttactctacctcatactaaaacttttggactttttt
ggacacttgagaactttcagacaggtcttacgagtattttttacacgaccgagttatgga
gtgcctgccagcaagagacagtgttcagatatggatggtatttgtacaatatgtcaagcg
gaatttcagaagccagttcttctcttttgtcagcatatattctgtgaagaatgtatcacc
ttatggtttaacagagagaaaacatgtccactgtgcagaactgtgatttcagaatgtata
aacaaatggaaagatggggccacttcatctcacctccagatgtactaa

DBGET integrated database retrieval system