KEGG   Mus musculus (mouse): 76894Help
Entry
76894             CDS       T01002                                 

Gene name
Mettl15, 0610027B03Rik, AI303697, AW049952, Mett5d1
Definition
(RefSeq) methyltransferase like 15
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_5 Methyltr_RsmB-F Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 76894
NCBI-ProteinID: NP_084066
MGI: 1924144
Ensembl: ENSMUSG00000057234
Vega: OTTMUSG00000015096
UniProt: Q9DCL4
Position
2; 2 E3
AA seq 406 aa AA seqDB search
MLRYPYFYRTYNRLFSHFVDSGASNLDVCPHTIHTAVALHTESKAVEGTALCGPQKVYSS
EEKELEAMAKLHIPVMVDQVVHCLAPQKGQVFLDMTFGSGGHTRAILQKEPDVMVYALDR
DPVAYAIAEQLSRLYPTQIQALLGQFSQAEALLMKAGVQPGTIDGILMDLGCSSMQLDAP
ERGFSLRKDGPLDMRMDGDRYPDTPTASDVVNALDQQALASILRAYGEEKHAKKIASAII
QARSTYPISRTQQLASIVAGAFPPSAVYARKDLLQRSTHIATKTFQALRIFVNNELNELY
AGLRTAEKFLKTGGRLVALSFHSLEDRIVKRFLLGISMTERFNLSIRQKVKQTSQLDSDQ
ETEERHSVRAPLKWELIHKKVLTPEDQDVQDNPRGRSAKLRAAIKL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgatatccatatttttacagaacatataatagactgttttcacactttgtggat
tctggtgcatctaatttggatgtctgtccccacacaatccacactgcagtggcactgcat
actgaatctaaagctgtggaagggacagctctgtgcggccctcagaaggtctacagctct
gaagagaaagagttggaagccatggctaaattacatatcccagtaatggtggatcaagtt
gttcattgcttggcaccacaaaagggacaggttttcctagatatgacctttggttcagga
ggacatacaagagccattctgcagaaggaaccagatgttatggtctatgccttagaccgg
gacccagtggcttatgcaatagctgagcagctttcaagactgtatccgacacagatccaa
gctctgttgggccagttcagccaagcggaggcattgctaatgaaagctggagtgcagcca
ggaacgattgatggaatccttatggacctggggtgttcttccatgcaacttgatgctcct
gaacgaggtttctcccttcggaaagatggccccttggacatgaggatggatggagacagg
taccctgacacgcccactgcttctgatgttgtgaatgctttagatcaacaagcacttgca
tccatcctaagagcatatggagaggaaaaacatgccaaaaaaattgcttctgcgatcatt
caagcacgcagcacataccctatctctagaacccagcagcttgccagcattgttgcaggt
gcctttcctccctctgctgtctatgcaagaaaagacttgctacaaagatccacccacatc
gctaccaagactttccaagcccttcgcatctttgtgaacaatgagctcaatgagctctat
gcaggactgaggacagcagagaagtttctaaaaactggtggtcgcctggtcgccctctcc
ttccattccttagaagatcgtattgtcaaacgctttctgcttgggataagcatgacagaa
aggtttaacctgagcattagacagaaggtgaagcagacttcccagctggattcagatcag
gagactgaggagagacactctgtaagagcgcctctgaagtgggagctgatacacaagaag
gtacttactccagaagatcaagatgtccaagataaccccagagggcgctcagccaagctc
agagcagccatcaaattatga

DBGET integrated database retrieval system