KEGG   Mus musculus (mouse): 76901Help
Entry
76901             CDS       T01002                                 

Gene name
Jade2, 1200017K05Rik, AI480685, Phf15, mKIAA0239
Definition
(RefSeq) jade family PHD finger 2
  KO
K22155  E3 ubiquitin-protein ligase Jade-2 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    76901 (Jade2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    76901 (Jade2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     76901 (Jade2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Atypical E3
   76901 (Jade2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    HBO1 complex
     76901 (Jade2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H_2 zf-HC5HC2H PHD_2 PHD EPL1 C1_1 PRA-PH
Motif
Other DBs
NCBI-GeneID: 76901
NCBI-ProteinID: NP_955003
MGI: 1924151
Ensembl: ENSMUSG00000020387
Vega: OTTMUSG00000005611
UniProt: Q6ZQF7
Position
11; 11 B1.3
AA seq 829 aa AA seqDB search
MEEKRRKYSISSDNSDTTDGHVTSTSASRCSKLPSSTKSGWPRQNEKKPSEVFRTDLITA
MKIPDSYQLSPDDYYILADPWRQEWEKGVQVPAGAEAIPEPVVRLLPPLKGPPTQMSPDS
PTLGEGAHPDWPGGSRYDLDEIDAYWLELLNSELKEMEKPELDELTLERVLEELETLCHQ
NMAQAIETQEGLGIEYDEDVVCDVCRSPEGEDGNEMVFCDKCNVCVHQACYGILKVPTGS
WLCRTCALGVQPKCLLCPKRGGALKPTRSGTKWVHVSCALWIPEVSIGCPEKMEPITKIS
HIPASRWALSCSLCKECTGTCIQCSMPSCITAFHVTCAFDRGLEMRTILADNDEVKFKSL
CQEHSDGGPRSEPTSEPVEPSQAVEDLEKVTLRKQRLQQLEENFYELVEPAEVAERLDLA
EALVDFIYQYWKLKRRANANQPLLTPKTDEVDNLAQQEQDVLYRRLKLFTHLRQDLERVR
NLCYMVTRRERTKHTICKLQEQIFHLQMKLIEQDLCREPSGRRSKGKKNDSKRKGREGPK
GSSPEKKEKVKAGPESVLGQLGLSTSFPIDGTFFNSWLAQSVQITAEDMAMSEWSLNSGH
REDPAPGLLSEELLQDEETLLSFMRDPSLRPGDPARKARGRTRLPAKKKPSPLQDGPSAR
TTPDKQPKKAWAQDGKGTQGPPMRKPPRRTSSHLPSSPAAGDCPVPATLESPPPLASEIL
DKTAPMASDLNVQVPGPTVSPKPLGRLRPPREMKVSRKSPGARSDAGTGLPSAVAERPKV
SLHFDTEADGYFSDEEMSDSEVEAEDSGVQRASREAGAEEVVRMGVLAS
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaagaggcgaaaatattccatcagcagcgacaactctgataccactgacggt
cacgtgacatccacatcagcatcaagatgttccaaactgcccagcagcaccaagtcgggc
tggccccggcagaacgagaagaagccctcagaggttttccggacagacttgatcacagcc
atgaagatcccagattcataccagctcagcccggatgactactacatcctggcggacccg
tggcgacaagaatgggagaaaggggtgcaggtacctgctggagcggaggccattccagag
cctgtggtgaggctcctcccaccactgaaaggcccccccacgcagatgtccccagatagc
cccacacttggtgagggtgcccatcctgactggccaggaggcagccgctacgacctggat
gagatcgatgcgtactggttggaacttctcaactcggagctcaaggagatggagaagccc
gagctggatgagctaacgttagagcgtgttctagaggagctagagacattgtgccaccag
aatatggcacaggccattgagacacaggaggggctgggcatcgagtacgacgaggacgtt
gtctgcgacgtgtgccgttcccctgaaggcgaggatggcaacgagatggtcttctgtgac
aaatgcaatgtctgtgtgcaccaggcatgctacgggatcctcaaggtgcctacgggcagc
tggctgtgccggacctgtgccctgggagtccagcctaagtgcctgctctgccccaagcga
ggaggagccctgaagcccactagaagtgggaccaagtgggtacacgtcagctgtgccctg
tggattcctgaggtcagcattggctgtccagagaagatggagcccattaccaagatctcg
catattccggccagccgctgggccctgtcctgcagcctctgcaaggagtgcacaggtacc
tgcatccagtgttccatgccttcctgcatcacagcattccacgttacgtgcgcctttgac
cgaggcctggaaatgcggactatattagctgacaatgacgaggtcaagttcaagtcactt
tgccaggagcacagtgacgggggccctcggagtgagcctacttctgagcctgtggagccc
agccaggccgttgaggatctggaaaaggtgaccttacgcaagcagcggctgcagcagctg
gaagaaaacttctatgagctagtggagccagctgaggtggctgaacggctagacctggct
gaggcactggtggacttcatctaccagtactggaagttgaagcggagagctaatgccaac
cagccgctgttgacgcccaagactgacgaggtggacaacctggcccaacaggaacaggat
gtcctctatcgacgcctgaagcttttcacccacctgcggcaggacctggagagggtaagg
aacctgtgctacatggtgacaagacgggagagaacgaaacacaccatctgtaaacttcag
gagcagatattccatctacagatgaaacttattgagcaagacctttgcagagagccttct
gggaggaggtcaaagggcaagaagaatgattcaaaaaggaaaggccgagagggtcccaag
ggcagcagccctgagaagaaagagaaagtgaaggctgggcccgagtctgtgctggggcag
ctgggtctatccacctcgttccccatcgacggcactttcttcaacagctggttggcacag
tcggttcagatcacagcagaggacatggccatgagcgagtggtctttgaacagtgggcac
cgggaggatcctgctccaggtctgctgtcagaggaattgctacaagatgaggagacgctg
ctcagcttcatgagggacccctcgctacgacctggtgaccctgccagaaaggcccgaggc
cgcactcgcctgcctgccaagaagaaaccatccccgctgcaggatgggcccagtgcacgg
accactccagacaagcaacccaagaaggcctgggcccaggatggcaaggggacgcaagga
ccacccatgaggaagccaccacggaggacgtcttctcatttgccgtccagccctgcagct
ggggactgtccagtcccagcaacactggaaagccctccaccactggcctccgagatacta
gacaagacagcccccatggcttccgacttaaatgtccaagtgcctggccctacagtgagc
cccaaacccttgggcaggctccggccaccccgagagatgaaggtcagtcggaaatctccg
ggtgctagatccgatgctgggacaggactaccgtctgctgtggccgagaggccaaaggtc
agcctgcattttgacaccgaggctgacggctacttctctgatgaggagatgagcgattct
gaggtagaggcagaggacagtggggtacaacgagcttccagggaggcaggggcagaggag
gtggttcgcatgggggtgctggcctcctaa

DBGET integrated database retrieval system