KEGG   Mus musculus (house mouse): 76916
Entry
76916             CDS       T01002                                 
Symbol
Timmdc1, 2810021C21Rik, 4930455C21Rik
Name
(RefSeq) translocase of inner mitochondrial membrane domain containing 1
  KO
K23505  complex I assembly factor TIMMDC1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    76916 (Timmdc1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    76916 (Timmdc1)
SSDB
Motif
Pfam: Tim17 C19orf12 DUF6861
Other DBs
NCBI-GeneID: 76916
NCBI-ProteinID: NP_077235
MGI: 1922139
Ensembl: ENSMUSG00000002846
UniProt: Q8BUY5
Position
16:complement(38318205..38343075)
AA seq 285 aa
MGAPPPAPRSRLCGAWGPFPRVFAAGAVAADSPGFVEDREQRSGVSDPGSLESGWDRLRQ
LFAKDEQQRFSKEIDYIYRAAVSAGIIGWAYGGIPAFIYAKKRYIEQSQAEIYHNRFDAV
QSAHRAATRGFIRYGWRWSWRTAVFVTIFNTVNTGLTVYRNKDAMSHFAIAGAVTGGLFR
INLGVRGLVAGSIIGALLGAPMGSLLMALEKYSGETVQERRQKEWKALHEQRLEEWRSSL
QVTELLPMEIESGLEKIQPEGDAQRIEELLSLPRNPSSPHQQSKH
NT seq 858 nt   +upstreamnt  +downstreamnt
atgggcgcgccgccgcccgctccccgcagccgcctttgcggagcctggggtcctttcccc
cgagtctttgctgccggtgcggtggctgcggattccccaggctttgtggaggatcgggag
cagcgttcaggtgtctcagaccccggttccctggaatccggatgggaccgcctccggcag
ctgtttgccaaagatgaacaacagagattctcaaaggaaattgactatatctacagggca
gcagtttcagcaggcatcattggctgggcatatggaggaatacctgcttttatttatgct
aaaaaacgctacattgaacagagccaagcggagatttatcataaccgatttgatgctgtg
caaagtgcacaccgtgctgccacaaggggcttcatccggtatggctggcgctggagttgg
agaactgcagttttcgtgaccatatttaacacagtgaacactggactaactgtgtatcga
aataaagacgccatgagccattttgccattgcaggagctgtcacaggaggtcttttcaga
ataaacttaggtgttcgaggcctggtggctggtagtataattggagcgttgttgggcgcg
cccatgggaagcttgctgatggccctggagaagtactccggtgagacggttcaggagaga
aggcagaaggaatggaaggccttgcacgagcagaggctggaagagtggagaagcagtctg
caagtcactgagctcctcccgatggagattgaaagtggcttggagaagattcagcctgag
ggagacgctcagaggattgaggagctgctaagcctccctaggaacccttcatcgccacat
caacaaagcaagcactga

DBGET integrated database retrieval system