KEGG   Mus musculus (mouse): 76932Help
Entry
76932             CDS       T01002                                 

Gene name
Arfip2, 2310002N04Rik, POR, Por1
Definition
(RefSeq) ADP-ribosylation factor interacting protein 2
  KO
K20314  arfaptin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    76932 (Arfip2)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Others
   Others
    76932 (Arfip2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arfaptin BAR BAR_3
Motif
Other DBs
NCBI-GeneID: 76932
NCBI-ProteinID: NP_084078
MGI: 1924182
Ensembl: ENSMUSG00000030881
Vega: OTTMUSG00000025509
UniProt: Q8K221
Position
7; 7 E3
AA seq 341 aa AA seqDB search
MTDGILGKAATMEIPIHGNGEAGQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGD
GLIPTGSGRHPSHSTSPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSR
TVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQE
EFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRT
DLEELSLGPRDAGTRGRLESAQATFQTHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLL
FHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgggattctagggaaggcagccacaatggagattcccatccacggaaatggc
gaagctgggcagcttcctgaagacgatgggctggagcaggacctccagcaggtgatggtg
tcaggacccaacctcaatgaaactagcattgtgtctggtggctatgggggctctggtgac
ggactcatccccacagggtctggccgacatccatctcacagcacgtcaccctctggccct
ggtgacgaggtggcccggggcatcgctggagaaaagtttgacatcgtcaagaaatggggc
atcaacacatataagtgcacaaagcagctgttatcagagagatttggccgaggctcccgg
actgtggatctggagctagagctgcagattgagttgctgcgtgagacgaagcgcaagtat
gaaagtgtcctgcagctgggccgggcactgacagcccacctctacagcctgttgcagacc
cagcatgcactaggtgatgcctttgctgacctcagccagaagtccccagagcttcaggag
gaatttggctataatgcagagacacaaaagctgctgtgcaagaatggggagacgctgcta
ggggctgtgaacttctttgtctctagcatcaacacactggtcaccaagaccatggaagac
acactcatgactgtcaaacagtatgaggctgccaggctggaatatgatgcctaccggaca
gacttagaagagctgagcctagggccccgggatgcagggactcgtggtcgacttgagagt
gcccaggccactttccagacccatcgggacaaatatgagaagctgcggggagatgtggcc
atcaagctgaagttcctggaagaaaacaagatcaaggtgatgcacaagcagctgctgctc
ttccacaatgccgtgtctgcctacttcgctgggaaccagaaacagctggagcagactctt
cagcagttcaacatcaagctgcggcctccaggagccgagaagccttcctggttagaggag
cagtga

DBGET integrated database retrieval system