KEGG   Mus musculus (house mouse): 76933
Entry
76933             CDS       T01002                                 
Symbol
Ifi27l2a, 2310061N23Rik, Ifi27, Isg12, Isg12(b1)
Name
(RefSeq) interferon, alpha-inducible protein 27 like 2A
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Ifi-6-16
Other DBs
NCBI-GeneID: 76933
NCBI-ProteinID: NP_084079
MGI: 1924183
Ensembl: ENSMUSG00000079017
UniProt: Q8R412
Position
12:complement(103400132..103409939)
AA seq 90 aa
MLGTLFGSAIGGALAVAGAPVALAAMGFTGTGIAAASIAAKMMSAAAIANGGGVAAGSLV
ATLQSAGVLGLSTSTNAILGAAGAAVGALL
NT seq 273 nt   +upstreamnt  +downstreamnt
atgttgggaacactgtttggctctgccataggaggagctctggctgtggcaggggcacct
gtggccctggctgccatgggcttcactgggacaggcattgcagctgcctccatagcagcc
aagatgatgtctgctgcagcaattgccaatggaggtggagttgcagcaggaagcctggta
gccacactccaatcagcaggggtccttggactctccacatcaacaaatgccatcctaggg
gctgctggggcagctgttggagccttgctctga

DBGET integrated database retrieval system