KEGG   Mus musculus (mouse): 76936
Entry
76936             CDS       T01002                                 

Symbol
Hnrnpm, 2610023M21Rik, AA409009, Hnrpm, mKIAA4193
Name
(RefSeq) heterogeneous nuclear ribonucleoprotein M
  KO
K12887  heterogeneous nuclear ribonucleoprotein M
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    76936 (Hnrnpm)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    76936 (Hnrnpm)
Spliceosome [BR:mmu03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    76936 (Hnrnpm)
SSDB
Motif
Pfam: RRM_1 HnRNP_M_NLS MARF1_RRM1 RRM_3 Collagen_mid RRM_5 RRM_occluded
Other DBs
NCBI-GeneID: 76936
NCBI-ProteinID: NP_084080
MGI: 1926465
Ensembl: ENSMUSG00000059208
Vega: OTTMUSG00000033297
UniProt: Q9D0E1 Q570Z0
Position
17:complement(33865207..33904432)
AA seq 729 aa
MAAGVEAAAEVAATEPKMEEESGAPCVPSGNGAPGPKGEERPTQNEKRKEKNIKRGGNRF
EPYSNPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFKM
EESMKKAAEVLNKHSLSGRPLKVKEDPDGEHARRAMQKVMATTGGMGMGPGGPGMINIPP
SILNNPNIPNEIIHALQAGRLGSTVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDG
KSRGIGIVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKGDFFPPERPQQLPHGL
GGIGMGLGPGGQPIDANHLSKGIGMGNLGPAGMGMEGIGFGINKIGGMEGPFGGGMENMG
RFGSGMNMGRINEILSNALKRGEIIAKQGGGGAGGSVPGIERMGPGIDRISGAGMERMGA
GLGHGMDRVGSEIERMGLVMDRMGSVERMGSSIERMGPLGLDHMASSIERMGQTMERIGS
GVERMGAGMGFGLERMAAPIDRVGQTIERMGSGVERMGPAIERMGLSMDRMVPTGMGASL
ERMGPVMDRMATGLERMGANNLERMGLERMGANSLERMGLERMGANSLERMGPAMGPALG
AGIERMGLAMGGAGGASFDRAIEMERGNFGGSFAGSFGGAGGHAPGVARKACQIFVRNLP
FDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFESPEVAERACRMMNGMKLSGRE
IDVRIDRNA
NT seq 2190 nt   +upstreamnt  +downstreamnt
atggcggcaggggtcgaagcggcagccgaagtggcggcgacagaacccaaaatggaggaa
gagagcggcgcgccctgcgtgccgagcggcaacggagctccgggcccgaagggtgaagaa
cgacctactcagaatgagaagaggaaggagaaaaacataaaaagaggaggcaatcgcttt
gagccatattccaacccaactaaaagatacagagccttcattacaaatataccttttgat
gtgaaatggcagtcacttaaagacctggttaaagaaaaagttggtgaggtaacatacgtg
gagctcttaatggacgctgaaggaaagtcaaggggatgtgctgttgttgaattcaagatg
gaggagagcatgaaaaaagctgctgaagttctaaacaagcatagtctgagtggaaggcca
ctgaaagtcaaggaagatcctgatggtgaacatgcaaggagagcaatgcaaaaggtgatg
gctacgactggtgggatgggtatgggaccaggtggcccaggaatgattaatatcccaccc
agtatcctaaataatcctaacatcccaaatgagattatccatgcattacaggctggaaga
cttggaagcacagtatttgtagcaaatctggattataaagttggctggaagaaactgaag
gaagtatttagtatggctggtgtggtggtccgagcagacattctggaagataaagatggg
aaaagtcgtggaataggcattgtgacttttgaacagtccattgaagctgtgcaagcaata
tctatgtttaatggccagttgctgtttgatagaccgatgcacgtcaagatggatgagagg
gctttaccaaagggagacttttttcctcctgaacgcccacagcaacttccccatggactt
ggtggtattggcatgggattaggacctggaggtcagcctattgatgccaaccatctgagc
aaaggcattggaatgggaaacctaggacctgcagggatgggaatggaaggcataggattt
ggaataaataaaattggaggcatggaaggaccctttggtggtggtatggaaaacatgggc
cgatttggatccgggatgaacatgggccgaataaatgaaatcctaagtaatgcactgaag
agaggagagatcattgcaaaacagggaggaggtggagctggaggcagtgtccctgggatc
gagaggatgggccctggcattgaccgcattagcggtgctggcatggagcgcatgggcgca
ggcttaggccatggcatggatcgagtgggctctgagattgagcgcatgggcctggtcatg
gaccgcatgggctcagttgagcgcatgggctccagcattgagcgcatgggcccactaggc
cttgaccacatggcctccagtattgagcgcatgggccagaccatggagcgcattggttct
ggcgtggagcgcatgggtgccggcatgggcttcggcctggagcgcatggccgcacccatt
gaccgtgtgggccaaaccattgagcgcatgggctctggtgtagagcgcatgggtcctgcc
attgaacgcatgggcctaagcatggatcggatggtgcccacaggcatgggggccagcctg
gagcgcatgggtcctgtgatggatcggatggccaccggcctggagcgcatgggcgccaac
aacctggagcgcatgggcctggagcgtatgggagccaacagtcttgagcgcatgggcctg
gagcgaatgggcgccaacagcctggaacgtatgggccctgccatgggcccagcattgggc
gctggtattgagcgaatgggcctggccatgggtggagccggaggtgctagctttgaccga
gccattgagatggagcggggcaactttggaggaagcttcgcaggttcctttggcggagct
ggaggccatgcacctggagtagccaggaaggcctgccagatatttgtgagaaatctccca
tttgattttacatggaagatgctaaaggacaagttcaatgaatgtggccacgtgctgtac
gccgacatcaagatggagaacggaaagtccaaggggtgcggtgtggttaagtttgagtct
ccagaggtggctgagagagcctgccggatgatgaatggcatgaagctgagtggccgagag
attgatgttcgaattgatagaaatgcttaa

DBGET integrated database retrieval system