KEGG   Mus musculus (house mouse): 77031
Entry
77031             CDS       T01002                                 
Symbol
Slc9a8, 1200006P13Rik, 6430709P13Rik, NHE-8, NHE8
Name
(RefSeq) solute carrier family 9 (sodium/hydrogen exchanger), member 8
  KO
K14724  solute carrier family 9 (sodium/hydrogen exchanger), member 8
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    77031 (Slc9a8)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   77031 (Slc9a8)
SSDB
Motif
Pfam: Na_H_Exchanger
Other DBs
NCBI-GeneID: 77031
NCBI-ProteinID: NP_683731
MGI: 1924281
Ensembl: ENSMUSG00000039463
UniProt: Q8R4D1
Position
2:167261678..167318920
AA seq 576 aa
MAEEEFSNTTHETFNFTLHTTLGVTTKLVLPTPAKPILPVQTGEQAQQEEQSSGMTIFFS
LLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAVIKVIEFKKLANWKEEEMFRPNM
FFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTAISAFVVGGGIYFLGQADVISKL
NMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVFGESILNDAVSIVLTNTAEGLTR
KHMSDVSGWQTFSQALGYFLKMFFGSAALGTLTGLISALVLKHIDLRKTPSLEFGMMIIF
AYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSPVTQILMQQTLRTVAFLCETCVFAF
LGLSIFSFPHKFEISFVIWCIVLVLFGRAVNIFPLSYLLNFFRDHKITPKMMFIMWFSGL
RGAIPYALSLHLGLEPMEKRQLIGTTTIVIVLFTILLLGGSTMPLIRLVDIEDARARRRS
KKDVNLSKTEKMGNAIESEHLSELTEEEYEAHYIRQQDLKGFMWLDAKYLNPFFTRRLTQ
EDLHHGRIQMKSLTNKWYEEVRQGPSGSEDDEQELF
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggcggaggaggagttctccaacacaacccatgagaccttcaacttcacccttcacacc
accttgggtgtcaccacgaagctggtgctgccgacacctgccaagcctatccttccggtg
cagacgggagagcaggcccagcaggaggagcagtcgagcggcatgaccattttcttcagc
ctcctcgtcctagccatctgcatcatcctggtgcacctgctgattcggtaccgcctgcac
tttctgcctgagagcgtggctgtggtttctctaggtattctcatgggagcagtaataaaa
gttatagagtttaaaaagctggcaaattggaaggaggaagaaatgtttcgccccaacatg
tttttccttctcttgctcccacctattatctttgagtcaggatactcactgcacaagggg
aacttctttcagaacatcggttccatcactctcttcgctgtctttggaacggcaatctcg
gcttttgtagtaggtggaggaatttactttctgggtcaggctgatgtaatctctaaactc
aacatgacagacagtttcgcatttggctccctgatatctgcagtcgacccagtcgccact
attgcgattttcaacgcactgcatgtggaccctgtgctcaacatgctggtgtttggagaa
agcattctcaacgatgcagtctccatcgtcctcaccaacacggctgaaggtctaacaaga
aaacatatgtcagatgtcagtgggtggcaaacgttctcacaggcccttggctacttcctc
aaaatgttctttggctccgcagcacttggcacgctgactggcttgatttcagcattagtg
ttgaagcacattgacctgaggaaaacgccttccctggagtttggcatgatgatcattttt
gcttacctgccatatgggctggcagaaggaatctcactctcaggcatcatggcgatcctg
ttttctggcatcgtgatgtcacactatacacaccataacctctccccagtcacccagatc
ctcatgcagcagactctccgaactgtggccttcctgtgtgaaacgtgtgtgtttgcattt
cttggcctctccatttttagtttccctcacaagtttgaaatttcctttgtcatctggtgc
atagtgctggtcctgtttggcagagccgtcaacatcttccctctgtcctacctgctgaac
ttcttccgagatcacaaaatcacccccaagatgatgttcatcatgtggttcagtggtctt
cgaggggccatcccctatgcactaagcctgcacctgggcctggagcccatggagaagcgt
cagctcatcggcaccaccaccatcgtcatcgtgctcttcaccatcctgctgctgggcggc
agcaccatgcccctcatccgcctcgtggacatcgaggatgcccgggctcgccgaaggagc
aagaaagacgtcaacctcagcaagactgagaagatgggtaatgccatcgagtcagagcac
ctgtcagagctcactgaagaagagtacgaagctcactacatcagacagcaggacctcaaa
ggcttcatgtggctggatgccaagtacctgaaccccttcttcacacggcggctgacacag
gaggacctccaccatggccgcatccagatgaagagcctcaccaataagtggtatgaggag
gtccgtcagggaccgtcaggctctgaggatgatgagcaggagttgttctga

DBGET integrated database retrieval system