KEGG   Mus musculus (mouse): 77035
Entry
77035             CDS       T01002                                 

Gene name
Kdm8, 3110005O21Rik, Jmjd5
Definition
(RefSeq) lysine (K)-specific demethylase 8
  KO
K10277  [protein]-arginine 3-hydroxylase / protease [EC:1.14.11.73 3.4.-.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    77035 (Kdm8)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.73  [protein]-arginine 3-hydroxylase
     77035 (Kdm8)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     77035 (Kdm8)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   77035 (Kdm8)
SSDB
Motif
Pfam: Cupin_8 Cupin_4 JmjC Cupin_2
Other DBs
NCBI-GeneID: 77035
NCBI-ProteinID: NP_084118
MGI: 1924285
Ensembl: ENSMUSG00000030752
Vega: OTTMUSG00000023596
UniProt: Q9CXT6
Position
7; 7 F3
AA seq 414 aa
MSEDTTEPLVGSSTLWKELRTLLPDKEEELKLDLGEKVDRSVAALLRQAVGLFYAGHWQG
CLQASEAVLDYSWEKLNTGPWRDVDKEWRRVYSFGCLLKALCLCQAPQKATTVVEALRVC
DMGLLMGAAILEDILLKVVAVLQTHQLPGKQPARGPHQDQPATKKAKCDASPAPDVMLER
MVPRLRCPPLQYFKQHFLVPGRPVILEGVADHWPCMKKWSLQYIQEIAGCRTVPVEVGSR
YTDEDWSQTLMTVDEFIQKFILSEAKDVGYLAQHQLFDQIPELKRDISIPDYCCLGNGEE
EEITINAWFGPQGTISPLHQDPQQNFLVQVLGRKYIRLYSPQESEAVYPHETHILHNTSQ
VDVENPDLEKFPKFTEAPFLSCILSPGDTLFIPAKYWHYVRSLDLSFSVSFWWS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgtcagaggacaccacagagcccctggtggggtccagcaccctctggaaggagctcagg
acgctcctgcctgacaaagaggaggagctgaagctggacctcggtgagaaggtggacagg
agcgtggctgcgcttttgcggcaggctgtgggtctattctacgcgggccattggcagggg
tgcctgcaggccagtgaggccgtcctagactactcctgggaaaagctcaacactggtccc
tggagagatgtagacaaggagtggcgccgggtatattccttcggctgcctcctgaaggcc
ctgtgcctgtgccaggcaccacagaaggccactactgtggtggaagcactgcgggtgtgt
gacatgggcctgttgatgggggcagccatcctcgaggacattcttctcaaagttgtcgca
gtcctccagacacaccagctcccaggaaagcagcctgcccgcggcccccaccaggatcag
cctgccaccaagaaggcaaagtgtgacgccagcccagctcctgatgtcatgttagagcgg
atggtacccaggctccgctgcccacctctgcagtacttcaagcagcattttctagttcct
gggaggcctgtgatcttggaaggtgtggccgaccactggccgtgcatgaagaagtggagt
ctgcagtacatccaggagattgctggctgccgcaccgtccccgtggaagtgggctcaagg
tacacagatgaagactggtcccagactctcatgacagtcgatgagttcatccagaagttc
atcctgagcgaggcaaaggatgtcgggtaccttgctcagcaccagctcttcgaccagatc
ccagagttgaagcgggacatcagcatccctgattactgttgcctgggcaatggagaagag
gaagagatcactatcaatgcctggtttggtccacaaggcaccatctccccactgcatcag
gacccccagcagaacttcctggtccaggtgctaggaaggaagtacatccgattgtattcg
ccgcaagagtctgaggcagtgtaccctcacgagacgcacattcttcataacaccagccag
gttgatgtggaaaaccccgaccttgagaagtttcccaagttcactgaggccccattcctg
tcctgcattctgtccccaggagacaccctctttatacctgctaagtactggcattatgtg
cgctccctggacctgagcttctctgtcagcttctggtggtcatag

DBGET integrated database retrieval system