KEGG   Mus musculus (house mouse): 77042
Entry
77042             CDS       T01002                                 
Symbol
Hyal4, 4632428M18Rik, CSHY
Name
(RefSeq) hyaluronoglucosaminidase 4
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00531  Glycosaminoglycan degradation
mmu01100  Metabolic pathways
mmu04142  Lysosome
Module
mmu_M00076  Dermatan sulfate degradation
mmu_M00077  Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    77042 (Hyal4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    77042 (Hyal4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:mmu02042]
    77042 (Hyal4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    77042 (Hyal4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    77042 (Hyal4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     77042 (Hyal4)
Bacterial toxins [BR:mmu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   77042 (Hyal4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Enzymes
   77042 (Hyal4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Enzymes
  77042 (Hyal4)
SSDB
Motif
Pfam: Glyco_hydro_56
Other DBs
NCBI-GeneID: 77042
NCBI-ProteinID: NP_084124
MGI: 1924292
Ensembl: ENSMUSG00000029680
UniProt: Q05A56 L0MX76
Position
6:24748366..24766518
AA seq 481 aa
MQLLPEGQLRLCVFQPVHLTSGLLILFILKSISSLKPARLPVYQRKPFIAAWNAPTDLCL
IKYNLTLNLKVFQMVGSPRLKDRGQNVVIFYANRLGYYPWYTSEGVPINGGLPQNTSLQV
HLKKAAQDINYYIPSENFSGLAVIDWEYWRPQWARNWNTKDIYRQKSRTLISDMKENISA
ADIEYSAKATFEKSAKAFMEETIKLGSKSRPKGLWGYYLYPDCHNYNVYATNYTGSCPEE
EVLRNNDLSWLWNSSTALYPAVSIRKSFADSENTLHFSRFRVRESLRISTMTSQDYALPV
FVYTQLGYKEEPLLFLSKQDLISTIGESAALGAAGIVVWGDMNLTSSEENCTKVNRFVNS
DFGSYIINVTRAAEVCSRHLCKNNGRCVRKTWKAAHYLHLNPASYHIEASEDGEFIVRGR
ASDTDLAVMAENFLCHCYEGYEGADCREMTEASGPSGLSLSSSSVITLCLLVLAGYQSIQ
L
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgcaactattgcctgaaggacaattaagactctgtgtttttcaaccagtacatcttaca
tcggggctgctcatactttttatcctgaagtctatctcatccctaaaacctgcccgactt
ccagtttatcaaaggaaaccttttattgctgcttggaatgctccaacagacctgtgtttg
ataaaatataatttaacactgaacttaaaagtgtttcagatggttggaagccctcggctc
aaagacagggggcaaaatgttgttatattttatgccaacagattgggatattacccatgg
tatacatcagaaggggtacccatcaatggtggtcttccccaaaacacaagcttacaagta
cacctgaaaaaagctgcccaggatattaattattacatcccttctgaaaatttcagtgga
cttgctgttatagactgggaatattggcgcccacagtgggcccggaactggaacacaaag
gatatctacagacagaagtcaagaactcttatttctgatatgaaagagaacatatctgct
gctgatattgaatattcagccaaggcaacttttgagaaaagtgcaaaagctttcatggag
gaaactatcaaattgggaagtaagagcagacccaagggcctttggggttattatttatat
cctgattgccacaattataatgtttatgccacaaactatactgggtcatgcccagaagag
gaagttttgaggaacaatgacctctcttggctctggaacagcagtacagccctgtatcct
gctgtcagtattaggaaatcctttgcagacagtgaaaacactttgcacttctcacgattt
cgggtgcgtgaatcactgaggatttccaccatgacatcacaggattatgctctgcctgta
tttgtctacacacagctgggctacaaagaggaacctttacttttcctttctaagcaagat
ctaattagtaccataggagaaagtgctgcgttgggagcggcaggcattgttgtttgggga
gacatgaatttaacttcatctgaggagaactgtacgaaagtgaaccgctttgtgaattct
gattttggcagctacataatcaatgtgaccagagcagctgaggtgtgcagtcgtcacctt
tgcaagaataatgggaggtgtgtacggaagacatggaaagcagctcattacctccatttg
aaccctgcaagttaccacatagaggcctctgaggatggagaattcatagtgaggggaaga
gcatcagacactgacctagctgtgatggcagagaatttcctatgtcactgttatgaggga
tatgagggggctgactgtagagaaatgacagaggccagtggcccctcggggctttccctt
tcctctagctctgtaataacactgtgtctgctagttctagcaggttatcaaagcattcag
ttgtga

DBGET integrated database retrieval system