KEGG   Mus musculus (house mouse): 77055
Entry
77055             CDS       T01002                                 
Symbol
Krt76, 2310001L23Rik
Name
(RefSeq) keratin 76
  KO
K07605  type II keratin, basic
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    77055 (Krt76)
   04147 Exosome [BR:mmu04147]
    77055 (Krt76)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     77055 (Krt76)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   77055 (Krt76)
  Exosomal proteins of other body fluids (saliva and urine)
   77055 (Krt76)
  Exosomal proteins of colorectal cancer cells
   77055 (Krt76)
  Exosomal proteins of bladder cancer cells
   77055 (Krt76)
SSDB
Motif
Pfam: Filament Keratin_2_head CENP-F_leu_zip ATG16 TPR_MLP1_2 BicD Baculo_PEP_C Jnk-SapK_ap_N DUF4407 ADIP DUF4618
Other DBs
NCBI-GeneID: 77055
NCBI-ProteinID: NP_001028349
MGI: 1924305
Ensembl: ENSMUSG00000075402
UniProt: Q3UV17
Position
15:complement(101792786..101801355)
AA seq 594 aa
MSRQACKKSFSCGSQGFSGHSAVVSGSSRSSCVARSGAASGGACGFRSGAGSLGSHSLYS
LGGSKSISISVAAGGSRAGGFSGGRSSCGSGFGSGYGGSLGGSRGMGAGFGGPSGFGGAG
GFGRPGSFGPGSCPGGIQEVTINQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFASFI
DKVRFLEQQNKVLETKWELLQQQTIRSGSGPQNLEPFFESYISCLRKQLDSLLGAKGSLE
GELKSMQDLVEDFKKKYEEEINRRTAAENEFVGLKKDVDGAFMNKVELQAKVDSLTDEIN
FLRTLYDMELSQIQSHVSDTSVVLSMDNNRCLDLDSIIAEVKAQYEDIAQKSKAEAEALY
QTKLGELQTTAGRHGDDLRSTKSEIMDLNRMIQRLRAEIENVKKQNTNMQTSIAEAEQRG
ERALKDADTKFQDLQVALQKAKEDMARLLKEYQELMNVKLALDVEIATYRKLLEGEECRL
SGEFQNAVSISVVSNVTSTSSSGSFRGTGGSNYGGDSSGRSGGSSSSSSRGSSSRGSSGS
RLGSGGSISVSQQRMGFNSGGSQTSVGSSYKSGRGGSSSVQFSQTTSSSQQRSK
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgagcagacaagcctgcaagaaatccttcagttgtgggagccagggcttctctggccac
tcagctgtggtatctggcagcagcaggagcagctgtgtggctcgctctggggcagccagt
ggaggggcttgtgggttccggagcggagcaggtagccttggcagtcacagcctctacagc
ctgggtggcagtaagagtatttctatcagcgtggcggctggtggctcccgggctggtggc
ttcagtggagggcgtagcagctgtggcagtggctttggaagtggctatggaggtagcctt
ggtggtagtagaggaatgggagctggctttgggggcccttctggatttgggggagctggt
ggctttggtaggcctggtagctttggccctggtagctgccctggtggaatccaggaagtg
accatcaaccagagcctcctgcagcccctcaatgtagagattgacccccagattgggcaa
gtgaaggcccaggagcgtgaacagatcaagaccctcaacaacaagtttgcttccttcatc
gacaaggtgcgcttcctggagcagcagaacaaggtcctggagaccaagtgggagctgctg
cagcagcagaccatacgctctggctcaggaccccagaacctggaacctttctttgaatcc
tacatcagctgcctgcgcaagcagttagattcacttctgggggcgaaggggagcctggag
ggagagctgaagagcatgcaagacctggtagaagacttcaaaaagaagtatgaagaggag
atcaacaggcgtactgctgcagagaatgaatttgtagggctgaagaaggatgtagatgga
gctttcatgaacaaagtggagctgcaggctaaagtggacagtctgacagatgaaatcaac
tttctgaggactctctacgacatggagctgtcccagatacagagtcatgtcagtgacaca
tctgtggtcctgtccatggacaacaaccgctgcctggacctggacagcatcatcgctgag
gtcaaggcccagtatgaggacattgcccagaagagtaaggctgaggctgaggccctgtac
cagaccaagcttggggagttacagaccacagctggcaggcatggtgatgacctgaggagc
accaagagcgagatcatggatctcaacaggatgatccagagactgcgagcggagattgag
aatgtcaagaagcagaacaccaacatgcagacatccattgcagaggctgaacagcgtggt
gagcgggccctcaaggatgcagataccaaattccaagacttgcaggttgctctgcagaag
gccaaggaggacatggcccggctgctgaaggagtaccaggagctcatgaatgtcaagctg
gccctggatgtggagatcgccacctacaggaagctactggagggcgaggagtgcaggttg
tctggagagtttcagaatgctgtgagcatttcagtggtcagcaatgttaccagcacaagc
agcagcggaagcttcagagggaccggtggcagtaactacggaggggatagcagtggcaga
agcggcggcagcagcagcagcagcagcagaggcagcagcagcagaggcagcagtgggagc
agacttggcagtggaggcagcatctccgtgagccagcagagaatgggctttaactctggt
ggcagccagacctcagtaggcagcagctacaagtctggcagaggaggcagcagcagtgtt
cagttctctcagaccaccagttcaagccagcaacgctccaagtga

DBGET integrated database retrieval system