KEGG   Mus musculus (mouse): 77110Help
Entry
77110             CDS       T01002                                 

Gene name
Gpbp1l1, 5330440M15Rik, BC002292
Definition
(RefSeq) GC-rich promoter binding protein 1-like 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Vasculin
Motif
Other DBs
NCBI-GeneID: 77110
NCBI-ProteinID: NP_084144
MGI: 1924360
Ensembl: ENSMUSG00000034042
Vega: OTTMUSG00000009410
UniProt: Q6NZP2
Position
4; 4 D1
AA seq 473 aa AA seqDB search
MAQHDFVPAWLNFSTPQSSKSSTATFDKHGEHLSRGEGRFGISRRRHNSSDGFFNNGPLR
TTGDSWHQPSLFRHDSVDSGVSKGAYAGTTGWHGSSRGHDGMSQRSGGSSTGNHRHWNGS
FHSRKGCAFQEKTPTEIREEKKEDKVEKLQFEEEDFPSLNPEAGKQNQPCRPVGTPSGVW
ENPPSAKQPSKMLVIKKISKEDPAAAFSAAFTSSGSHHANGNKVSTMVPSVYKNLVPKPA
PPPSKPNAWKANRTEHKPGSLCSSRESAFTNPISVTKPVGLAAGAGLHSPKESPSSTTPP
IEISSSRLTKLTRRTTDRKSEFLKTLKDERNGDCSESRDCDKLEGLRLEGSHTPEPKENG
EQGCLQNGLSLPMVEEGEVLSHSLEAEHRLLKAMGWQEYPENDESCLPLTEDELKEFHLR
TEQLRRNGFGKNGLLQSRSCSLSSPWRSTCIAECEDSDSETSSSQTSDDDAWK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcatgactttgttcctgcttggctaaatttctcaacgccacagtcatctaag
tcatctacagccacctttgacaaacacggagagcacctatcccgtggagaaggtagattt
ggaataagccgtcgtcgacataattcctctgatggcttttttaacaatggacctctacgg
actacgggagattcttggcaccaaccctccctattccgccatgattctgttgactctggt
gtctctaagggagcatatgctggaaccacaggttggcatggctcttcccgaggtcatgat
ggtatgagccaacgtagtggaggtagtagtacaggaaaccaccgacactggaatggcagc
ttccattcccggaaaggctgcgcctttcaagaaaaaacaccaactgagattagggaagaa
aagaaagaggataaagtagaaaagttgcagtttgaagaggaagacttcccttctttgaat
ccagaagctggcaaacagaatcagccctgcagacctgttgggaccccttctggagtgtgg
gaaaatccacctagtgccaagcaaccctcaaagatgctagtcatcaaaaaaatttccaaa
gaggatcctgctgctgccttttctgctgcattcacctcctcaggatcccaccatgcaaat
gggaacaaagtgtcaacaatggtcccaagtgtctataagaacttggtgcctaagcctgca
ccacctccctctaagcccaacgcctggaaagctaacagaacggaacacaaacctggatca
ctttgctctagccgggagtctgctttcaccaatccaatttctgttactaaaccagtggga
ctggctgctggtgcaggtctccactctcccaaagagagtccctccagtactacccctcca
attgagatcagctcctctcgtctgaccaaattgacccgacgaaccacagacaggaagagt
gagttcctgaagactctgaaggatgaacgaaatggagactgctcagaaagtagagactgt
gacaagctggaggggctaagattggagggcagccacacacccgaaccaaaggaaaatgga
gaacaaggttgtcttcagaacggtctttctctacccatggtagaggaaggggaggttctg
tcacactctctggaagcagagcacaggttattaaaagcaatggggtggcaggagtaccct
gaaaatgatgagagctgccttccactcacagaggacgagctcaaggagttccacctgaga
acagagcagctacgaagaaatgggtttggaaagaatggcctcttacaaagccgtagttgc
agcctgtcctccccgtggagaagcacttgcattgcagagtgtgaggactcagactcggaa
acgagcagcagccagacgtcagacgacgatgcctggaagtag

DBGET integrated database retrieval system