KEGG   Mus musculus (mouse): 77117
Entry
77117             CDS       T01002                                 

Gene name
Zfp934, 6720457D02Rik
Definition
(RefSeq) zinc finger protein 934
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-H2C2_5 C1_1 zf-C2H2_jaz zf-C2HE C1_4 zf-met zf-C2H2_11
Other DBs
NCBI-GeneID: 77117
NCBI-ProteinID: NP_001156383
MGI: 1924367
Ensembl: ENSMUSG00000074865
UniProt: K7N6H3
Position
13; 13 B3
AA seq 473 aa
MNAVTYEDLHVNFTQEEWALLDPSQKKLYKHVMLETYRNLNAIGFNWEAQNIEEHCQSSR
RHRRCERSQSAEKPSEYTQRDKAFALSAHSHAQRHERIHTEKIPSEDIHCVEDVLPYTSL
QVHKRTQTGQKPYECKQCGKGFAKPSHLKRHERYHTGEQPFTCNECDKVFSFKHHLQTHI
SIRTGEKPFKCNLCDKSFSKHNHLQSHRRTHTGEKPYKCDQCDKAFSEKCNLQTHIRIHS
GEKPYKCDQCDKTFSEKCHLQKHIRIHTGEKPYKCNQCDKAFSQYNTLKTHRRTHTGEKP
YKCNQCDKAFSQYGHLQTHRRTHTGEKPYKCNQCDKAFSQYNTLKTHRRTHTGEKPYKCN
QCDKAFSEKCSLQRHIRIHTGEKPYKCNQCDKAFSQYSTLQTHRRTHTGEKPYKCNQCDK
AFSQYSNLQTHRRTHTGEKPYKCNQCDKAFSMKCNLQNHVRIHTGQKPFKCNQ
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaatgcagtgacttatgaggacctgcatgtgaacttcactcaagaggagtgggctctg
ctggatccttctcagaagaagctctacaaacatgtcatgctggagacctacaggaacctc
aatgctataggctttaattgggaagcccaaaatattgaagaacattgtcaaagttctaga
agacacagaaggtgtgaaaggagtcagagtgcagagaaaccctctgaatatactcaacgt
gataaagcctttgctttatctgctcacagtcatgcccaaaggcatgaaaggattcataca
gaaaagatcccctctgaagatattcactgtgtcgaagacgttttaccttacactagtctc
caagtacataaaagaacacaaactggacagaaaccctatgaatgtaaacaatgtggtaaa
ggatttgcaaagcccagtcatcttaaaaggcacgaaagatatcatactggagagcaaccc
ttcacatgtaatgaatgtgataaagtcttttcttttaaacatcatctccaaacacatata
agcatacgtactggagagaaacccttcaaatgtaatctgtgtgataaatccttttcaaaa
cataatcatcttcaaagtcatagaagaacacatactggagagaaaccctacaaatgtgat
caatgtgataaagccttttctgagaaatgtaatctccaaacacatataaggatacattct
ggagagaaaccctacaaatgtgatcaatgtgataaaaccttttctgagaaatgtcatctc
caaaaacatataaggatacatactggagagaaaccctacaaatgtaatcaatgtgataaa
gccttttctcaatacaatactcttaaaactcatagaagaacacatactggagagaaaccc
tacaaatgtaatcagtgtgataaagccttttctcaatacggtcatcttcaaactcataga
agaacacatactggagagaaaccctacaaatgtaatcagtgtgataaagccttttctcaa
tacaatactcttaaaactcatagaagaacacatactggagagaaaccctacaaatgtaat
cagtgtgataaagccttttctgagaaatgtagtctccaaagacatataaggatacatact
ggagagaaaccctacaaatgtaatcagtgtgataaagccttttctcaatacagtactctt
caaactcatagaagaacacatactggagagaaaccctacaaatgtaatcaatgcgataaa
gccttttctcaatacagtaatcttcaaactcatagaagaacacatactggagagaaaccc
tacaaatgtaatcagtgtgataaagccttttctatgaaatgtaatctccaaaaccatgta
aggatacatactggacaaaaacccttcaaatgtaatcaatga

DBGET integrated database retrieval system