KEGG   Mus musculus (mouse): 77128Help
Entry
77128             CDS       T01002                                 

Gene name
Crebrf, A930001N09Rik, LRF
Definition
(RefSeq) CREB3 regulatory factor
  KO
K21554  CREB3 regulatory factor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    77128 (Crebrf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2
Motif
Other DBs
NCBI-GeneID: 77128
NCBI-ProteinID: NP_084146
MGI: 1924378
Ensembl: ENSMUSG00000048249
Vega: OTTMUSG00000033233
UniProt: Q8CDG5
Position
17; 17 A3.3
AA seq 640 aa AA seqDB search
MPQPSVSGMDPPFGDAFRSHTFSEQTLMSTDLLANSSDPDFMYELDREMNYQQNPRDNFL
SLEDCKDIENLETFTDVLDNEDALTSNWEQWDTYCEDLTKYTKLTSCDIWGTKEVDYLGL
DDFSSPYQDEEVISKTPTLAQLNSEDSQSVSDSLYYPDSLFSVKQNPLPPSSFPSKKITN
RAAAPVCSSKTLQAEVPSSDCVQKASKPTSSTQIMVKTNMYHNEKVNFHVECKDYVKKAK
VKINPVQQGRPLLSQVHIDAAKENTCYCGAVAKRQERRGVEPHQGRGTPALPFKETQELL
LSPLTQDSPGLVATAESGSLSASTSVSDSSQKKEEHNYSLFVSDNMREQPTKYSPEDDED
DEDEFDDEDHDEGFGSEHELSENEEEEEEEEDYEDDRDDDISDTFSEPGYENDSVEDLKE
MTSISSRKRGKRRYFWEYSEQLTPSQQERILRPSEWNRDTLPSNMYQKNGLHHGKYAVKK
SRRTDVEDLTPNPKKLLQIGNELRKLNKVISDLTPVSELPLTARPRSRKEKNKLASRACR
LKKKAQYEANKVKLWGLNTEYDNLLFVINSIKQDIVNRVQNPREEREPSMGQKLEILIKD
TLGLPVAGQTSEFVNQVLGKTAEGNPTGGLVGLRIPASKV
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagcccagcgtaagcggaatggacccgccttttggggatgcctttcgaagccac
accttttcagaacagactctgatgagcacagatctcttagccaacagttctgatccagat
ttcatgtatgagctggatagagagatgaattatcaacagaatcctagagacaacttcctt
tctttggaagactgcaaagacattgaaaatctggagactttcacagatgtcctggacaat
gaggatgctttaacttcaaactgggaacagtgggatacatactgtgaagacttaactaag
tacacgaagctcaccagctgtgacatttgggggacaaaagaggtggattacctgggtctt
gatgacttttctagcccttaccaagatgaagaggtcatcagtaaaactccaacactggcc
cagctcaatagtgaggactctcagtctgtttccgattccctttattatcctgactcactc
ttcagtgtcaaacaaaatcccttgcccccctcctcttttcctagtaaaaagatcacaaat
agagcagctgcccctgtgtgttcttcaaagacacttcaggctgaggtcccatcatcagac
tgtgtccaaaaagcaagcaaacctacttcaagcacacagatcatggtgaagaccaacatg
tatcataatgaaaaggtgaattttcatgttgaatgtaaagactatgtaaaaaaagcaaaa
gtcaagatcaaccctgtgcaacagggccggcccttgctgagccaggtccacatagatgca
gcaaaggagaacacctgctactgtggagctgtggcaaagagacaggagagaaggggggtg
gagccgcatcagggtcggggcactcctgctttgcctttcaaagaaacccaggagctatta
cttagtcctctgacgcaggatagtcctgggttggttgccacagcagagagtggcagcctt
tctgccagcacttctgtttcagattcatcccagaaaaaagaagagcacaattattctctt
tttgtctctgacaacatgagagaacagccaaccaaatacagtcctgaagatgatgaggat
gatgaagatgagtttgatgatgaggaccatgatgaagggtttggcagcgagcatgagctt
tctgaaaatgaagaggaggaagaagaggaagaggattatgaggatgacagagatgatgat
atcagcgacacgttctctgaaccaggttatgaaaatgactctgtagaggacttgaaggag
atgacgtccatatcttctcggaagagagggaaaagaaggtacttctgggagtatagtgag
cagcttacaccatcacagcaagagaggattctgaggccttctgagtggaatcgagatacc
ttgccaagtaatatgtaccagaaaaatggcttacatcatgggaaatacgcagtgaagaaa
tcacggagaactgatgtggaagaccttactccaaaccctaaaaaactacttcagattggt
aatgagctgcgcaagctgaataaggtgatcagtgacctgactccagttagtgagcttccc
ttaacagcaaggccaaggtcaaggaaagaaaaaaataagctggcatccagagcttgtagg
ctaaagaagaaagcccagtatgaagctaataaagtgaagttgtggggcctcaacactgaa
tatgacaatttattgtttgtaatcaactccatcaagcaagacattgtaaaccgagttcag
aatccaagagaagagagagaacccagcatggggcagaagcttgaaatcctcattaaagat
acactgggtctcccagtcgctgggcaaacctcagaatttgttaaccaagtgttagggaag
actgctgaaggcaaccccactggaggccttgtaggactaaggataccagcatcaaaagtg
taa

DBGET integrated database retrieval system