KEGG   Mus musculus (mouse): 77219
Entry
77219             CDS       T01002                                 

Gene name
Ptgr2, 1810016I24Rik, 9130222H03Rik, 9630002F03Rik, AI838763, B830026H24Rik, PGR, PGR-2, PRG-2, Zadh, Zadh1
Definition
(RefSeq) prostaglandin reductase 2
  KO
K13949  prostaglandin reductase 2 [EC:1.3.1.48]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    77219 (Ptgr2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.48  13,14-dehydro-15-oxoprostaglandin 13-reductase
     77219 (Ptgr2)
SSDB
Motif
Pfam: ADH_N_2 ADH_zinc_N ADH_zinc_N_2
Other DBs
NCBI-GeneID: 77219
NCBI-ProteinID: NP_001239554
MGI: 1916372
Ensembl: ENSMUSG00000072946
Vega: OTTMUSG00000032610
UniProt: Q8VDQ1
Structure
PDB: 
2ZB3 1VJ1

Position
12; 12 D1
AA seq 351 aa
MIIQRVVLNSRPGKNGNPVAENFRVEEFSLPDALNEGQVQVRTLYLSVDPYMRCKMNEDT
GTDYLAPWQLAQVADGGGIGVVEESKHQKLTKGDFVTSFYWPWQTKAILDGNGLEKVDPQ
LVDGHLSYFLGAIGMPGLTSLIGVQEKGHISAGSNQTMVVSGAAGACGSLAGQIGHLLGC
SRVVGICGTQEKCLFLTSELGFDAAVNYKTGNVAEQLREACPGGVDVYFDNVGGDISNAV
ISQMNENSHIILCGQISQYSNDVPYPPPLPPAVEAIRKERNITRERFTVLNYKDKFEPGI
LQLSQWFKEGKLKVKETMAKGLENMGVAFQSMMTGGNVGKQIVCISEDSSL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgatcatacaaagagtggtattgaattcccgacctgggaaaaatggaaatccagtcgca
gagaacttcagggtggaagagttcagtttaccggatgctctcaatgaaggtcaagttcaa
gtgaggactctttatctctcggtggatccttacatgcgctgtaagatgaacgaggacact
ggcactgactacttggcaccgtggcagctggcgcaggtggctgatggtggaggaattgga
gttgtagaggagagcaagcaccagaagttgactaaaggcgattttgtgacttcgttttac
tggccctggcaaactaaggcaattctagatgggaatggccttgaaaaggtagacccacaa
cttgtagatggacacctttcatattttcttggggctataggtatgcctggcttgacttcc
ttgattggggtacaggagaaaggccatatatctgctggatctaatcagacaatggttgtc
agtggagcagcaggcgcctgtggatctttggctgggcagattggccacctgcttggctgt
tccagagtggtgggaatttgtggaacgcaggagaaatgtctctttttgacctcagagctg
gggtttgatgctgcagttaattacaaaacagggaatgtggcagagcagctgcgagaagcg
tgcccgggcggagtggatgtctactttgacaatgttggaggtgacatcagcaacgcggtg
ataagtcagatgaatgagaacagccacatcatcctgtgtggtcagatttctcagtacagt
aacgatgtgccctaccctcctccactgccccctgcagtagaagccatccggaaggaacga
aacatcacaagagagagatttacggtattaaattataaagataaatttgagcctggaatt
ctacagctgagtcagtggtttaaagaaggaaagctaaaggtcaaggagaccatggcaaag
ggcttggaaaacatgggagttgcattccagtccatgatgacagggggcaacgtagggaaa
cagatcgtctgcatttcagaagattcttctctgtag

DBGET integrated database retrieval system