KEGG   Mus musculus (mouse): 77220
Entry
77220             CDS       T01002                                 

Gene name
Tmem200a, C030003D03Rik
Definition
(RefSeq) transmembrane protein 200A
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: DUF2371 Neurensin
Other DBs
NCBI-GeneID: 77220
NCBI-ProteinID: NP_084157
MGI: 1924470
Ensembl: ENSMUSG00000049420
UniProt: Q8C817 B2RUN2
Position
10; 10 A4
AA seq 491 aa
MIATGGVITGLAALKRQDSARSQQHINLSPLPATQDQKPVRRRPRADVVVVRGKIRLYSP
SGFFLILGVLVSIIGIAMAVLGYWPQKEHFIDAETTLSTNETQVVRNQGGVVVRFFEQHL
HSDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMRDIYSTVIDIHTLRLKEQKQ
ANGLYAGLLGDTEVKQNGSPCASRLAATTLASFSGMRNSFRVDSSVEEDELMLTESKSLG
HLMPPLLSDSAVSVFGLYPPPAKATDDKASSSKKCDTKSIVSSSISAFTLPVIKLNNCVI
DEPSIDSITEVADNLKTRSRNLSMDSLVVPLPSSGESFQPAVTLLPRNNSVGESLSSQYK
SSVALGPGTGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRGPSTLTVHAEQRKHPSWP
RLDRSNSKGYMRLENKEDPMDRLLVPQTAIKKDFTNKEKLLMISRSHNNLSFEHDEFLSN
NLKRGTSETRF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgatagccactggtggggtcatcaccggcctggcggccttgaagcggcaggactctgcc
aggtctcagcaacacattaacctcagcccactgcctgctacccaggatcagaaacccgtc
agacggcgcccacgagcagatgttgtggtggtccgtgggaaaatccgactttattctcca
tctggctttttcctcattctgggagtgctggtgtccatcataggaatcgccatggcagtc
cttggatattggccccagaaggagcacttcattgacgcagagaccacgctgtccaccaat
gagacccaagtggttcggaaccagggcggtgtggtggtgcgcttctttgagcagcatcta
cattccgataagatgaagatgcttggcccgttcaccatgggcatcggcatcttcattttc
atctgcgccaatgccattcttcatgagaaccgcgacaaagaaaccaaaatcatccacatg
agggatatctactccacagtcatcgacatccacactctgagactcaaggagcagaagcag
gcaaatggcctatacgcaggcttgctgggagacacagaagtgaagcagaacggcagcccc
tgtgcatccaggctggctgccaccaccttggcctccttctcagggatgcggaacagcttt
cgggtggacagctctgtggaggaggatgaactgatgttgactgaaagtaagagcctgggg
cacctcatgcccccgttgctatctgacagtgcagtctctgtctttggcctttatccacct
ccagccaaggccaccgatgacaaggccagcagctccaagaagtgtgacaccaaatcgatt
gtgtcgtcatccatcagtgctttcacgctacctgtgatcaagcttaataactgtgtcatt
gacgagcccagtatagacagcatcactgaggtcgcagacaacctcaaaactaggtccagg
aatctttccatggattccctcgtggtcccactgccgagctctggtgagtcctttcagcct
gctgtcacgttactcccaaggaacaattccgttggggagtccctatctagtcaatacaag
tcctctgtggctctgggccccgggactggacagctcttgtctccgggagctgcaagaaga
cagtttggctccaacacatccttgcatttgctctcttctcactccaaatccctagactta
gacagaggtccttccacactcaccgtgcacgcagaacaaaggaagcacccgagctggccc
cggttggatcggagcaacagcaaagggtatatgagactggagaacaaagaggacccgatg
gatcggttgctcgttccccaaacagcaatcaaaaaagattttaccaataaagagaaactt
ctcatgatctcaagatctcataacaacttgagttttgaacatgatgagtttttgagtaac
aacttgaagcgaggaacttctgagacaaggttttag

DBGET integrated database retrieval system