KEGG   Mus musculus (mouse): 77286
Entry
77286             CDS       T01002                                 

Gene name
Nkrf, 9430034D17Rik, AW124770, C80287
Definition
(RefSeq) NF-kappaB repressing factor
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: XTBD G-patch R3H G-patch_2 dsrm S8_pro-domain
Other DBs
NCBI-GeneID: 77286
NCBI-ProteinID: NP_084167
MGI: 1924536
Ensembl: ENSMUSG00000044149
Vega: OTTMUSG00000017111
UniProt: Q8BY02
Position
X; X A3.3
AA seq 784 aa
MAGGRLLLGGDFLSPPPLPPLPPPPLPPLPPPPPEPVLEQWRYSHESDWQWALRRSFICR
HLHSYPGAALDQLLALSAAWTNHVFLGCRYSPHLMEKILHMAEGIDIGEMPSYDLMLPKP
SKGQKRYLSTYDGQNPPKKQAGSKFHVRARFEPVHFVASSSKAERQEDPYGPQTKDVNGR
THFASMPRNFYQDYTQDSFSIQDGNSQYCNSSGFIFTKDQPVATNMYFDSGNPAPSSTSQ
QANCQPAPEPPPSQMYPESLVAEKQYFIEKLTATIWKNLSNPEMTSGSDKINYTYMLTRC
IQACKTNPEYIYAPLKEIPPADIPKNKKLLTDGYACEVRCQNIYLTTGYAGSKNGSRDRA
TELAVKLLQKRIEVRVVRRKFKHIIGEDLVVCQIGMLSYEFPPALKPPEDLVVLGKDASG
QPIFNSSAKHWTNFVITENANDAIGILNNSASFNKMSIEYKYEMMPNRTWRCRVFLQDHC
LAEGYGTKKTSKHAAADEALKVLQKTQPTYPSVKSSQCHSGSSPKGSGKKKDIKDLVVYE
NSSNPVCTLNDTAQFNRMTVEYVYERMTGLRWKCKVILESEVIAEAVGVKKSVKYEAAGE
AVKTLKKTQPTVINNLKKGTVEDVISRNEIQGRSAEEAYKQQIKEDNIGNQLLRKMGWTG
GGLGKSGEGIREPISVKEQHKREGLGLDVERVNKIAKRDIEQIIRNYARSESHSDLTFST
ELTNDERKQIHQIAQKYGLKSKSHGVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVM
PQAN
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggctggaggacgtctgttgctggggggcgacttcctgtcgccgccgccgctgcccccc
ctcccgccgccgccgctgccgcccctcccgccgcccccgcctgagccagtgctggagcag
tggcgctatagccacgaaagtgactggcagtgggctctgcggcggagcttcatctgccgg
cacctgcacagctatcccggggctgccctggaccagctcctcgcgctctccgccgcctgg
acaaaccacgttttcctgggctgcaggtatagcccacacttgatggaaaaaattcttcac
atggctgaaggtattgatattggggagatgccgtcatatgatctaatgctgcccaaacct
tccaaaggccaaaaacgctacctttcaacctacgatggtcagaatcctcctaaaaagcaa
gccggttccaaattccatgtgagagctcgttttgagcctgtacattttgtagctagtagt
tcaaaagctgaaagacaggaagatccgtatggccctcaaacaaaagacgtaaatggacga
acacattttgccagcatgccaagaaacttctaccaagattatactcaagactctttcagt
atccaggatggaaattctcaatattgtaattcatcaggatttattttcacaaaagaccag
cctgtagcaaccaacatgtattttgacagtgggaaccctgccccaagcagcacatcccag
caggcaaactgtcagccagctcccgagcctcctccttcacagatgtaccctgagtccttg
gttgccgagaagcagtattttattgaaaagttaacagcaactatctggaagaacctttct
aatccagagatgacttctggatctgataagattaattatacctatatgctaactcgttgt
attcaggcatgtaagacaaatcctgagtatatatatgctcctttaaaagaaattcctcct
gctgacatccccaaaaataaaaaacttctcacggatggttatgcttgtgaagttagatgc
caaaatatctacctaactacaggttatgcaggtagcaagaatgggtccagagatcgagct
actgagctagctgtaaaactcttgcagaagaggattgaggttagagttgtccgacggaaa
ttcaagcacataatcggagaggaccttgtggtgtgtcagattggtatgctttcatatgaa
tttcccccagctctgaaaccaccagaagacctggtagtactgggaaaggatgcttctggg
cagcctatttttaatagttctgccaaacactggaccaattttgtcattacagaaaatgca
aatgatgcaattggcatccttaacaattccgcctcattcaacaaaatgtcaattgagtac
aaatacgagatgatgccaaaccgcacatggcggtgtcgagtattcctgcaagatcactgc
ttagctgaaggttatggaaccaagaaaacaagcaaacatgcagctgctgatgaggctttg
aaagttcttcaaaaaacacaacccacttatccatctgtcaaaagttcccagtgtcactca
ggctcttcacccaaaggatccggaaagaagaaagatatcaaagatcttgtagtttatgag
aattcttccaatcctgtgtgcacattgaatgatacggctcagtttaaccgaatgacggtt
gaatatgtctatgaaaggatgacaggtctccgctggaaatgcaaggtgattctagagagc
gaagtcattgcagaagcagttggtgtgaagaaaagtgtcaaatacgaagctgctggagaa
gctgtaaagaccctcaaaaagacccagccgactgtcattaacaacttgaagaaagggact
gttgaagatgtgatttcaagaaatgaaatccagggccgctcagcagaagaagcttacaaa
cagcaaatcaaagaagacaacatagggaatcaactgctgagaaagatgggctggacgggt
ggtggtttagggaaatctggtgagggcatacgggagcctatctcagttaaagagcagcat
aagcgagaaggccttggtctagatgtagagagggtcaataaaattgctaagagggatata
gaacaaattatcagaaactatgcccgctctgaaagccactcagatttgaccttctccacg
gagctgaccaatgatgaacggaagcaaatccatcagattgctcagaagtatggcctgaag
agtaagtctcatggggtgggccatgataggtacctggtggtaggtcgaaaacggcggaag
gaagacctactagatcaactcaaacaggagggccaagtgggacattatgagcttgttatg
ccccaagcaaactaa

DBGET integrated database retrieval system