KEGG   Mus musculus (mouse): 77300
Entry
77300             CDS       T01002                                 

Gene name
Raph1, 9430025M21Rik, C730009O10Rik, L, Lpd
Definition
(RefSeq) Ras association (RalGDS/AF-6) and pleckstrin homology domains 1
  KO
K23488  Ras-associated and pleckstrin homology domains-containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    77300 (Raph1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   77300 (Raph1)
SSDB
Motif
Pfam: RA PH PH_11 RBD
Other DBs
NCBI-GeneID: 77300
NCBI-ProteinID: NP_001038978
MGI: 1924550
Ensembl: ENSMUSG00000026014
Vega: OTTMUSG00000002211
UniProt: F2Z3U3
Position
1; 1 C2
AA seq 1266 aa
MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDRLTQSLDSDKPKEPVKRSPLRQET
NMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIGSGNSKRQVTEPKVPQK
LPAGRHTSKHGTLRGPSSSSNRTTKPSHANYSLDDITAQLEQASLSMDEAAQQSLVEDPK
PLVTNQHRRTASAGTVSDAEARSISNSSRSSITSAASSMDSLDIDKVTRPQELDLTTHQG
QPITEEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDN
LMDKSHCGYSLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYAL
FKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFL
LRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDCCLALKHPQIQKKS
QYIKYLCCDDARTLHQWVNGIRIAKYGKQLYTNYQEALKRTESAYDWTSLSSSSIKSGSS
SSSIPESQSNHSNQSDSGVSDTLPTGHIRSQSTVSSIFSEAWKRGTQLEESSKARMESMN
RSYTSLMPPLSPQTKIITPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSSGS
AATMFVKYSTITRLQNAAQHSGTLFKSPTPPAMQPLPLASQSKAQIVVPPNGVIPPPPPP
PPPPTPGSAMAQLKPVPCAPSLPQFSPQPPPLKIHQVQHLPQTAPPTPPPAPPITATVPP
QAPPKPLVTIPPSASTKTVSPVVAQAVPPTPAPPVPPAKKQPVFPVSHIPPTPPVQPTPH
PPPTLPKQQSFGVKPPPSPLSPVPSVVKQIASQFPPPPTPPPVDSQPLKSLPASGTPQSP
PAVKAKPKWQPSSIPVPSPDFPPPPPESSLVFPPPPPPAPAPAPPPPPPPPPPPPPVPPT
ASPTPDKGGSPGKKTSKMSSPGGKKPPPTPQRNSSIKSGSCAEHPEPKRPSVDSLVSKFA
PPAESGSPSKETPPPPAAPPKPGKLHLSGVNLPGIHQQGIVSAKASVLSGRGKDVVVEFP
SPPSDSDFPPPPPEIELPLPPIEIPAVFSGNTSPKVAVVNPQPQLWSKTSVKKAPPPTRP
KRNDSTRLTQADISEQPAMTTVVPQVPTSPKSSLSVQPGFLADLNRTLQRKSITRHGSLS
SSRMSRAEPTATMDDMALPPPPPELLSDQQKAGFGGSHISGYATLRRGPPPAPPKRDQNT
KLSRDW
NT seq 3801 nt   +upstreamnt  +downstreamnt
atggagcaactatccgatgaagagattgaccatggtgctgaagaagacagcgacaaggaa
gatcaggacctggataaaatgtttggggcctggcttggagaactggacaggcttactcag
agtttggattctgacaagcccaaagaaccagtaaaaagatctcctcttcgccaggaaaca
aatatggccaacttttcttaccgcttctccatatacaacttgaatgaagctctgaatcag
ggtgagactgtggacctggatgccctgatggctgacctctgctctatagagcaggagctc
agcagcattggctcaggaaatagtaagcgtcaagtcacagaaccaaaagttcctcagaag
ctacctgctggccgacatacgtcaaaacatggcaccctgagaggaccgtcatcttcctct
aatagaacaactaaaccttcccatgctaactactccctggatgacatcactgctcagtta
gaacaggcttccttgagcatggatgaggctgctcagcaatctctggtagaagatcctaag
cctttagtgacaaatcagcacagaaggactgcatcagcaggcactgtgagtgatgctgaa
gcgcgctccatcagtaactcctcccggtcaagcatcacctctgcagcctccagcatggat
tctctggatattgataaagtgacacgccctcaagagcttgatttgaccacacaccagggg
cagccaattactgaggaagaacaggcagcaaaactgaaagctgagaagatccgagttgct
ctggagaaaattaaagaggctcaagtgaaaaagctggtaatcagggtccacatgtctgat
gacagttctaagacaatgatggtggatgagagacagacagtgagacaagtgctggataac
ctgatggacaaatctcactgtggctacagtttagactggtcgctggtggaaaccatttcc
gagttacaaatggaaagaatctttgaagaccatgaaaacttggttgaaaatcttcttaat
tggacaagagacagccaaaataagcttatatttatggagcgtatagaaaaatatgcactt
tttaaaaacccccagaattatcttctagggaaaaaggaaacagctgaaatggcagacaga
aacaaagaagtgctgttagaggaatgtttttgtggaagttctgtaactgtcccagaaatt
gaaggagtcctttggttaaaagatgatggcaagaagtcctggaaaaagcgttattttctc
ttgcgagcatctggtatctactatgtccccaaaggaaaagcaaaggtatctcgggatcta
gtgtgctttctccagctggatcatgtaaatgtatactatggacaggactatcggaacaaa
tacaaagcacccacagactgctgcctggcattaaagcacccacagatccagaagaagtct
cagtatatcaagtacctttgctgtgatgatgcaaggaccctgcatcagtgggtcaatgga
atccgcattgccaagtatgggaagcagctctacacgaattaccaagaagccttgaagagg
acagagtccgcttatgattggacttcgttatccagctccagcattaaatccggatccagt
tcttccagtatcccggagtctcagtcaaaccactctaatcagtctgacagcggagtgtct
gacaccctgccaactggacatatccgttcccaaagtaccgtgagctccatcttctcggaa
gcctggaagcgaggcactcagctggaagagtccagcaaggccagaatggagtctatgaat
cggtcctacacttcacttatgccccctctgtcccctcaaactaagatcatcaccccctat
actgcctcacaaccttcaccgcctcttcctcctcctccgccaccacctcctcctcctcca
cctccgccaccaccacctcctcctcctcttcccagccagtctgcaccatcttcaggctca
gcagctaccatgtttgtcaagtacagcacaatcaccaggctgcaaaatgcagctcagcat
tcagggaccctgtttaagtctccaacaccaccagcgatgcagcctcttcctttggcttca
cagtccaaggctcaaattgtggtgccccccaatggagttattcctccaccccctcctccg
ccaccacccccaacccctggctcagccatggcccagttaaagccagtgccatgtgcccca
tccctaccacagttcagcccccaacctcctccactgaagattcaccaggttcagcacctt
cctcagacagcccctcctacacccccaccagctcctcccatcactgcaactgtccctcct
caagcaccccctaaacctctggtgaccatccctccttcagccagcacaaagactgtgtca
ccagtagtagcacaagctgtaccaccaacccctgcacctcctgtgccccctgcaaagaaa
cagccagttttccctgtttctcacattccacccactccccctgtgcagcctaccccacat
cccccccctacactacccaaacagcagagctttggggtaaagccacccccctctccactg
tcccctgtgccctccgttgtgaagcagatagccagtcagtttccaccccctcccactcct
cctcctgtggactctcagcccctaaagtccctgccagcaagtggcaccccacagtcccct
cctgcagtaaaagcaaaacccaaatggcagcccagctcaatccctgtcccttctccagat
ttccctcctccccctcctgaaagcagcctggtgtttcctccaccacctcctccagcccca
gccccagccccaccaccaccaccaccaccacctccaccaccgccaccagtgccacccacg
gcttcacctacccctgacaaaggtggatctccaggcaaaaagacaagtaagatgtccagc
cctgggggaaagaaaccacccccaaccccgcagcgcaactccagcattaagtccggcagt
tgtgcagagcaccctgagcccaagcgaccctcggtagacagtctagtcagcaagtttgca
ccgccagcagaatcagggtctcccagcaaagagaccccaccacctcctgcagcacccccc
aaacctgggaaactacacctttctggagtcaatctccctggaatccaccagcaagggatt
gtgtcggcaaaagcctctgttctgagtgggcgtggaaaggacgttgtagtggaatttcca
tcgccaccatctgattctgactttccaccccctccacctgaaatagagcttcctctgccc
cctattgagattccagctgtattctcggggaacacctcccccaaagtggcagttgttaat
cctcagccacagctatggtctaaaacatcagtgaagaaggcccccccacctacccggccc
aaacgcaatgacagcacccgcctcactcaagctgacatatctgaacagccagcaatgacc
acagttgtgccacaagtgcccacctctcctaaatccagccttagcgtccaacctggattc
ctagctgatcttaacaggacattgcagcgcaagtctatcacgcggcatggctccctgtcc
tcctcacgtatgtccagagcagaacccaccgccacaatggacgacatggcactaccccca
ccaccaccagaactgctgtctgaccagcagaaggctggctttggaggtagtcatatttcg
ggctatgcaacattgcgaagaggaccccctcccgctcctcctaagagagaccagaatact
aagctctcaagagactggtag

DBGET integrated database retrieval system