KEGG   Mus musculus (mouse): 77337Help
Entry
77337             CDS       T01002                                 

Gene name
Akr1c21, 9430025F20Rik, AI315367
Definition
(RefSeq) aldo-keto reductase family 1, member C21
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 77337
NCBI-ProteinID: NP_084177
MGI: 1924587
Ensembl: ENSMUSG00000021207
Vega: OTTMUSG00000027696
UniProt: Q91WR5
Structure
PDB: 

Position
13; 13 A1
AA seq 323 aa AA seqDB search
MNSKCHCVILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVYNTEDH
VGEAIRSKIADGTVRREDIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPM
ALKPGEENFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKP
GLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPV
LGSMAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLN
RNMRYIPAAIFKGHPNWPFLDEY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaactccaaatgtcattgtgtcatattgaatgatggtaacttcattccagtgctgggt
tttggtactgctcttcctctagagtgtcccaagagtaaagctaaggagctcaccaaaata
gctatagatgctggtttccatcactttgattctgcttctgtctataatactgaagatcat
gtaggagaggccatcagaagcaagattgctgatggcactgtaaggagagaagatatattt
tacacctcaaaggtttggtgtactagccttcacccagaacttgtgagagcttccttggaa
cggtcactgcaaaaacttcagttcgactatgtggacctgtatctcattcattacccaatg
gccctgaaaccaggagaagaaaattttccagtagatgaacatggaaaattaatatttgac
agagtggacctctgtgccacctgggaggccatggagaagtgtaaggatgcaggactaacc
aagtccattggggtgtctaactttaactatagacagttggagatgattctgaataagcct
gggctcaagtacaagccggtatgcaaccaggtagaatgccatccttatctcaaccaaatg
aaacttctggatttctgcaaatcaaaagatattgtattggttgcctatggtgttctagga
acacaacgatatggaggatgggtagaccagaattcccctgttctcttggatgaaccagtt
cttggttccatggcaaaaaaatataatcgaactccagccttgattgcccttcgctaccag
ttacagcgtgggattgtggtcctcaacaccagtctcaaagaggagcggatcaaagagaac
atgcaggtttttgaattccagctgagttcagaggatatgaaagttcttgatggcctgaac
agaaatatgcgatacatacctgctgccattttcaagggccaccctaattggccatttttg
gatgaatactag

DBGET integrated database retrieval system