KEGG   Mus musculus (mouse): 77505
Entry
77505             CDS       T01002                                 

Symbol
Dnhd1, 8030491N06Rik
Name
(RefSeq) dynein heavy chain domain 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DHC_N2 Dynein_C AAA_6 AAA_8 AAA_7 Dynein_heavy MT AAA_9 Dynein_AAA_lid AAA_lid_11 AAA_16 AAA_lid_1 GH3 AAA_29 AAA_22
Other DBs
NCBI-GeneID: 77505
NCBI-ProteinID: NP_001357732
MGI: 1924755
Ensembl: ENSMUSG00000030882
Vega: OTTMUSG00000025560
Position
7; 7 E3
AA seq 4749 aa
MKPHSQTSPPSLPMPSTSCRPGQTQKPKAWNWHLDPELWARSVRQQLNTCLHFILEEKKN
PWFYTLQSGLVGCSCSGQEHSWDCQMKQEDLKAVVESEQRTLLKLLLSELQSLFSAVMQD
GSCEAWRYLHAVLGLLPPYREMLAGQLELLPFLEQLYCWAPKVQARLELDLLDAIDKAFP
PDSSLLHSSSHVDCGLWMKRFHRGPPCSACPFVKAQWDRQQKKELATWLRPLTLPELQHC
LGIVGAEVALEETPWLDSLSLLPLALATDIPVQYESSDTEQAEGEPAGRKLQVASEAPEE
KALKKKSSRTPVLRSQVKSLLERDWTQKKIHFLYLNVVSDRHFNPYKLVAVPPDKVNPEH
YIFSPFGILHIHPVEGSEAMTLGTWHRDCALWRELQRIPFFKNCLLRKALTCWKKNVRLC
GLHRIQTFLKTHLLSAIPHFGAGMLHINRLLQEFRSVSWLPKEPDRSYELVDLQKAIAKE
NHKALRVLCHFLNLCTSILQLIHEDTYQMQQGLQERVQNWNRIRKGQGSIYLQRTLCRHL
EKKLKQAETWLLKLGKFARLIDYMICQNLVSILEDEISSFIANTLQAPRQNPFLLSQLVF
DDNGQLSPMPRVESIIQGLIKSLQSIKTSALKVLQSTDLRTSRDLLYSEDNKDQDSNAEF
LMPKFHGKASDAVRLFCGPNVGYVWPWKSHAITDVLEVRGHKLRGQFLHPNYDHVQEDLD
KNAGIQQALAVQQSLLEDMRQEVQEFCNKHKWVEGIYEFLKAWSSQKLEDLRGSPINNYV
NLVIQLKKWQERVSNMSVELLTKGKLLFLSGHDVQEELGSKLNNMRKNILEQAQNECWSR
NQQLMTELTEFLRVFQTISSDIHAIAQCSQKLSEANEQYCQLEERVEYVRSLHDLIRNHC
ALFIAENETLDIALLDLWEAFQFERSQVSEFLLSKQHAIVPRLQQLMAAALAELEGLLAK
ALSGPFMDPSQEQRSTEQQLGALEHQFLNILNNFNALCNAYCTFTGYKKPMSPPASGNRP
IVLQQRIWRLYRIISENLGEWKCVAFSKFNLSMAREKTDAWLTEAVRLSTALGLQSPVLQ
RCMRMLEEFRAYLPLLIKLGNLQLQDLNTQSLLRALGLGSLRSLDLLTLGQMLNYPLLEF
AERINQVWQYDKERIHAQEILQQMQQYWEGRQLRLLNFILHVPYKPPTSERSKRPALRSP
QWELVGKDSGTFLLSDYSSLQDAIQNSLQALFKILAIQKSGQLHKIALEWVAIMYGLGAL
LEVWVAFQQKWIFLNKVLHEMKIEFPAPELNARFKAMDDQYRTLMRISVADPMVLSLILP
NTKRSPYFQGQHLQQMLKAGSGELEAIIMALEDVLYGVCANFPRLFFLSDSELVALLAAP
LDTREAQLWAQRCFPHIKAVNFRSKSTKKKINQDSSSSTESAETIAVLAAGGEEVKLQEP
LPLHTDLPKWLASLEKCLRFIIVNLLQSCVATRLAQGPSLIKALKAMPQQRQMPMQVYVQ
HWLDAVQVFPWQCILVAEEVVWRAEMEEALLESRTMHMRSVHVHNLEVLVQFIRSQRSSQ
DGKSLPSVRQTSLFSTLLVKAVTHRDIAQLLEKNQVSDLTDFHWVRQLKYHLGSSHLNLK
SPVQCLTTIASTEPSVSPAACWIDVLGRSFMYNYEYMGPKLGPLPSLMHERQVFILLMAL
DEVAYGAILGRDGLGKAETVNSLAWTLGRQLVIMPCLPQIEFQCLRNYLNGALQSGAWLL
LENVNQLPSSLLSALGQRLDELHYLYAPLYQKASKNISTINPTKPLLLGGGFFEKHQVSM
RLGFGCFLTLHSLGPDIPANLHLLLRPVALALPDLQRVAELNLLGAGVQDASQMASRLSK
LFSLERELVSGNLPCRLPLLKQVLEHTIQTLNTSQEKKSQQPYDPAASEEAALLRALLHS
PLFSILDGLRLQKLQELLCGIFPNASHVLAEPVSHRLIKSVVVEELQQLGLFPASNTVTS
LEQLSQALSRASGILLLGPAGSGKSTCWRSLFKIQNRLAAMEHTSTKGFQSVEIVHLYPS
VLNSKEYLGWSEGPSWHYGIFPKLLHAAPYCKSVGSEEPSEKFTGIQQWIICDGAPNHAW
TDSVTCLLRDPPQLSLPNGQQIARPLGTFFLIEVAEAAGMSPTVLGRCALVWCSGEQTWH
SMLSVLMASLPHEYHLQQETITEFNYLAEVLVPSVLRFLTRIGASSQLQVHGHQAVCPGV
AEVTSLVRILRALLDPLLHLFEEEKSYTKEDFSGSDLVTQNFKSSKTRVQSDRVNVNKKQ
RRHLLAISSFLFAIIWSFGAHLPSRHWPLFDDFMKKSISSLPNYPEPPPSALVFDLHVNF
EDGTLVPFTGQYLSTHVKGNLGSFQPSSQTEQLLYVVDLLLSNGQPVLLAGEIATGKSAF
VEVLVKPNYPVIHSPIHPALNSTHLRHLLSRGVHGQTQASSIPGHHQDSKGSILFLMEDL
HLATFDPEKNCQPVLETLRQAMEGTIYAHNTLELQTLQTTVNFLATATVPGYSERPLCPR
LYRLFTVLALNSMTQDTLLSRHVPSIQAWLERFPSVEREHTLARALVRASVEAWEAVCKC
FMPSPLRPHYRFSPHSVSHILGSLQLLPTRMGSRGFAETFHHQEYLRRVSGLRGTRLTIM
MSMRVMVRLWLHEAQRTFCDRLDSDRERSHCAKLLLEVAQNVFCGGPGSESLAKDCEEEE
VEEEKVPEVESEEEIAQWETLSNSDSGSEEEEDPYGLQATTGSFLSENSLAPFPRKSVNK
ENTENVSQMAEQEEDIRDSSSKLQSKTPKHEWQMAPQMDLSLPLLLPVLLFYPQESPSDL
VFSLELTLGSNFESPNLYLERQWENLEKQLVATAVRLKMNSGFSQCPVMVQHVAHLVRVL
ARPQQHALLLSEFRGTGRYTAIILASSICQAHLHYLSVESEEAIFQCLRDASWHAGLLNQ
PVALLVPEGVNVAIFCRLLALATSGSFPDQYTEADLDNIEEHFPKENIANKHAIKRDTIL
NRFYQQVCNNLHMFFMVGDNQAQNQLAPTLFLNLLQLTIASVERYEPWDQASLVRIAQFC
LENDHSLPLDDGSLKYPDFKHLIPNVANIMARIHVSSACYHKHMCPALPLVTPKTFQDFL
DMFLQQQQQMVLQMRMRASRIQTALKTLRLMVERHSTQTSLLTDLEAQLKGSYKSVGICQ
GQLEQSKIMYRQKMIECQHQESLIENLVRQHDALKAQQEVFLEQMGKAFVGPLSQLRVAD
FEEIRSYRAPPESVVKVTDALCDLFHQETGWSSAKQLLCTEDFYQELVFFPKEKLTDSEL
VKLNEALRAPGMSDAALRSVSIPAANLAVWLWAVLRYGLAQRRGLPTGLLLRQVDATLAR
EQARLGQFQFQAHDLLEQTRSLTKKLEDAQVSHNHVMETLNQAQCGNFQKWPMESALLTP
MHMWTTQLQKLQEQAKTVFGDALLCSAAIIYLGPFPPQRRQELLEKWLSLCQGSEEALDP
DDVARALRQKSVGVPKNPLLPTRTPFSILTLLSYGSELHQWDRDLKPQAKSARLLGLLLR
SHIHFSSSRWPLLIDPSNQAIMWLNPLPPKQNRSLEPSPKESKEKFHVTKQDSGDNTEDE
LEDENNEEEDEANEQRKEQKAEENKIQGENEQEVQETEKENEPESSGSHSSLPSETQSLP
SCLTVLSGTDPELGPQLLEAAANGLPVLLTNVELSLGCQELQWLLSKKNLSPPSVQPGFC
LFLSTTFPIHALSRVLGFEMLKGLNVLDLGLNMEILEEQMLHEILCRERPELETRWQDLK
IRAADTYEAMKADEEQLLVTLLRQNQKRQKPSKFLRKMVRTQAKICQLNAQMEELEDQKQ
EVVALWAPYRPVAYHGMAMVEALSPLQNLLPSFCMTSENWLAVIRRAIDSMKSYDSYRGE
DLPSHLLRLKIHLARQLLTNTVVALGLIQTPLVGAFGALAMLQVTTKTPKLERLALWPGL
SASPSSGHNMQIPGVIRPAWLSSKAWEECGALELLPPFAGLCESLAGHSGVWQDYLSLSS
TVLGPAPGPNSEPLSLFQKLILWRVLRPDCLAGALADLTTSLLGRPLDENLGAPTMIFEH
IQPTQPILILLPPPGHPTATLHPVTVIRKLAANHEKPQHLHVIALGSEDWDPVSTVVNTL
CQAMLQGHWLVLDNCHLMPFWPRELLQPLQGLLDRARVVSDSELLAEPESRSVVTVHRDF
RLWLIVPTEASTSLPGMLTQSSMPVFWNQSLELGRILIDSLDSQQGLCTQPLTQTLPLFF
LHGLLLHRQLYGLKLQAHRGRWSQVTLTRALQIQEQLWASLGNPSAALLELTASVLYGGS
LGDLEDREALVSLTRTCLNPRNMNWDQPHTPQYLLATLMPSPELGELDARTDCKAQMHLL
PTPPEPRTCGLNEAPQAWLMRRQSRVLLNALQKCSSTWVPTVCGGIAQRKERQLQQRLAQ
AKKRLVALQALLTNNRIRSGQCVTPWAVLGPNARRPLEGFLETEVLELKHLVGTLLCDLD
CLLQQLKGGTPCTSSRCAKVAQALWAGHLPQPWRSHALAGSQLPWLWLRQLSRRGHLLIR
YLDSGMSENANKPERIFHLSAFRHPGRLLLALRWEAVLENSVHNPNLPGHQDSISGSLPP
KWQELSNHPLHIWVENGPNPKVPKMGLLLTGLQLQHAEWDQTDGALQDSFSSQPCPLPPV
SISTQARRGKDAPVSAGLGMYSCPVYMTGPFGTTKLHSKNILMHLPLPTRLSPDTCIQRR
VHVCSPTLT
NT seq 14250 nt   +upstreamnt  +downstreamnt
atgaaacctcattcacagaccagtcccccttcccttcccatgccttctacatcctgcagg
ccaggtcagacccagaagccaaaagcctggaattggcatttggaccccgagctgtgggca
agatctgttcgacagcaattgaatacctgcctccactttattctggaagagaagaaaaac
ccatggttttatacccttcagtctgggctcgttggatgtagctgcagcggacaagaacac
tcttgggactgtcaaatgaaacaggaggatctcaaggcagtggttgaatcagagcagcgg
acactgctgaagctgctgctgtctgagcttcagtctctgttctcagctgtgatgcaggat
ggcagttgtgaagcttggcgctatctgcatgcagtactgggcctgttgcctccataccgt
gagatgctagctggtcaactcgagttgctgcccttcctggagcagctgtactgctgggca
cccaaggtccaagcccggctagagctggacctgctagatgccatagacaaggcctttccc
ccagacagttctttgttacatagttcttcccatgttgactgtggtctatggatgaagagg
tttcatcgagggcctccatgctcagcatgcccttttgtgaaggcccagtgggaccggcaa
caaaaaaaggaattggccacgtggctccgaccattgacactgcctgagctacagcactgt
ctgggcattgttggtgctgaggtggccctagaagagaccccatggctggacagccttagt
cttttgcccttggcactggctacagacatccctgtacagtatgaaagcagtgatactgag
caggcagaaggcgaacctgctgggagaaaacttcaggttgcctctgaagctcctgaggag
aaggccctcaagaagaaaagctctaggactcccgtcttgagaagtcaggtgaaatccctt
ctggagagagactggacccagaagaagatccacttcctttatctcaatgtggtttctgat
cgtcactttaacccttacaagctggtggcagtgccaccagacaaggtgaatcctgagcac
tacatcttctctccctttgggatcctgcatatacatcctgtggagggcagtgaggcaatg
acactgggcacttggcaccgagactgtgctctctggcgtgagctccagcgcatcccattc
tttaagaattgcctcttgcgaaaggcgttgacctgttggaagaaaaatgtgaggttgtgt
gggctgcatcggatccagactttcttgaagactcatctgctctcggctattcctcatttt
ggagctgggatgctccatattaacaggcttcttcaagagtttcgttctgtgtcctggcta
cccaaagagccagataggtcctatgagctggtggacctgcagaaggcaatagccaaagag
aaccacaaggctcttcgagtgctctgtcactttctgaatctctgtacatccattcttcaa
ctgattcatgaagacacatatcaaatgcaacagggcctgcaggagagagtgcaaaactgg
aacaggatcaggaaaggccaaggctccatataccttcagaggacgctgtgcagacatctg
gagaagaagctgaagcaggccgaaacatggttgttgaagttgggaaagtttgcccgcctg
attgactacatgatttgtcagaaccttgtatccatcttagaagatgaaatatcttccttt
atagctaatactctgcaagccccaaggcaaaacccctttctcttatcacagctggtcttt
gatgacaatggtcagttgtcacctatgccccgtgttgaatctataatccagggtctcatt
aagagcctgcagtctatcaagacctctgccttaaaggtactgcagtctacagatctgagg
acctccagagatctcctgtattctgaagacaacaaagaccaggactcaaatgcagaattc
ctgatgcccaagtttcatggaaaggccagcgatgctgttcgcctcttctgtggccctaac
gtaggatacgtgtggccttggaagtctcatgcaattactgatgtcctggaagtccgtggg
cacaagctacggggtcagtttctgcaccccaattatgatcatgtgcaggaggacttggac
aagaatgctggaatccaacaggcacttgctgtacaacagtcactcttggaggacatgagg
caggaggtgcaggaattctgcaataaacacaagtgggtagaaggcatctatgagttcctg
aaagcctggagctctcagaagctagaggacctgagaggctctcctattaacaattatgta
aatctggtaatccaactgaaaaagtggcaggaacgtgtctccaatatgtctgtcgaatta
ctgacaaaaggcaagttgctgttcctgagtggccatgatgttcaagaagagttgggatcc
aagttaaataacatgaggaagaacattcttgaacaggcgcaaaatgaatgctggagccgt
aatcagcagctgatgacagaactgacagagttcttgcgggtcttccaaaccatcagctca
gacatccatgccattgcacagtgctcccagaaactaagtgaagccaatgagcaatactgc
cagctagaggagcgagtggaatatgtccgatcactccatgacctcatccgaaaccactgt
gccctcttcattgctgagaatgagactctagacattgcgcttctagatttatgggaggca
tttcaatttgaaagaagccaggtttcagagttcctgctcagcaagcaacatgccattgtg
cccaggctgcagcagctgatggcagcagcattggcagagctggaaggcctgctagcgaag
gcactgtctggtccctttatggatccttcacaagaacagaggagcactgagcaacagctt
ggtgccttggagcatcagttcctgaatatactcaataacttcaatgccctatgcaatgct
tactgcaccttcactgggtataagaagcctatgtctcctcctgcttctgggaaccggcct
atagtactgcagcagcgcatctggcggctttaccggatcatctctgaaaacctgggcgag
tggaaatgcgtggcttttagcaagttcaacctttctatggcccgggagaagaccgatgcc
tggctgacagaggctgtaaggctcagcacagccctggggctgcaaagccctgtgctacaa
cgctgtatgcgcatgctagaggagtttcgagcctatctgcctttgcttattaagctgggc
aacctccagctgcaggaccttaatactcaatccctcttgagagcattagggctgggtagt
ctacgaagcttggacctccttacactgggccagatgctcaattatccactgctggaattt
gcagaacgaatcaatcaggtctggcagtacgataaggaacggattcatgcccaagagatc
ctacagcagatgcagcagtactgggaggggcgccagctgcgcctgctcaacttcatcctg
catgtgccctacaagcccccaacctcagagcgctctaaaaggccagcactccgaagcccc
cagtgggagttagtgggcaaagatagtggcaccttcctcctctcagactacagcagcctg
caagatgccatccagaacagtctccaggctctattcaagatcctagccatccaaaagtca
ggacagttgcataaaatagctttagaatgggtagccatcatgtatggcctgggtgccctg
ctggaggtatgggtggctttccagcagaagtggatttttctgaataaagtgctacatgag
atgaagatcgagtttcctgctcctgagctgaatgctcgtttcaaggccatggatgatcag
tatcggactctaatgcgcatctctgtggctgacccaatggttctgtcacttatactgccc
aacaccaagaggagcccttacttccaaggccagcatctacagcaaatgctgaaagcagga
tcaggagagctggaggccatcatcatggctctggaggatgtcctctatggggtatgtgcc
aacttcccccgcctcttcttcctcagtgacagtgaactggtggccctgttggctgcccct
ctagatacccgcgaggcccagctatgggcacagcgttgttttcctcacattaaagctgtg
aacttcaggtccaaatcaactaaaaagaaaattaaccaggattcaagctcaagtacagag
agtgcggagacaattgctgtgctagcggcaggtggagaggaagtgaagcttcaggaaccc
cttcctctacatacagatcttcctaagtggctagcctctttggagaagtgtctgcggttt
ataatagtgaacctgctgcagagctgtgtggccacccgccttgctcaaggcccatccctc
attaaggctttgaaggcaatgcctcaacaaagacagatgcccatgcaagtgtatgtccag
cactggctagatgcagtccaagtttttccatggcagtgtatactggtggcagaggaggtg
gtgtggcgagctgagatggaggaggctttgcttgagtcaaggactatgcacatgcgttcc
gtacatgtacacaatcttgaggtactggtgcaatttatacgctctcagaggagctctcag
gatgggaagtctctgccttctgttcgccagactagtctattcagtaccctgctggtcaag
gcagtgactcatagggatatagcccaactcctggagaagaaccaagtcagtgatctgaca
gacttccactgggtccgccaacttaagtatcacctgggttcatctcacttgaacctcaaa
agccccgtgcagtgtcttacaactattgcatctactgagccctctgtgtcacccgctgca
tgctggatagatgtgctcggccggtccttcatgtacaattatgagtacatggggcccaaa
ctggggcctctacctagcctgatgcatgagcgtcaagtatttattctcttaatggcctta
gatgaggtggcctatggggccatacttggcagggatggtctgggcaaggcagaaactgtg
aatagcctggcatggaccctgggccgccagctggtaataatgccctgcttgccccagata
gagttccaatgtctgagaaattatctgaatggtgcccttcagagtggtgcctggctgctg
ttagagaatgttaaccaactaccttctagcctgctctctgccctgggccagcgtctggat
gaactgcactatctttatgccccactatatcagaaagcttccaaaaacataagtaccata
aaccctactaaacccctactccttggtggtggtttctttgagaagcatcaagtgtctatg
cgtcttggctttggctgtttcttgacacttcattccctgggtcctgatatacctgccaat
ctgcatctgctactgcgtcctgtggcattggcactgcctgaccttcagagagtggcagag
ctgaacctgctgggagcaggggtacaagatgcctcccaaatggcttctcgcctatctaaa
ttattttccctagaacgtgagctggtgtctgggaacttgccctgccgcttgccactgctc
aagcaggtactggaacacacaatacagacactaaatacatcccaagaaaagaagtcccag
cagccctacgaccccgctgcctctgaggaggctgccctactgcgtgccctgttgcattca
ccactgttcagcattctcgatggcctccgtctacaaaagctccaagaactgctctgtggg
atttttcctaatgctagccatgtgctggctgagcctgtgtcccatagactgattaaatca
gtagtggtggaagaactccagcagttaggcctatttcctgcctctaacacggtgacatct
ctggagcagctgagtcaggccctgagccgggcctctggcattctgctcctgggccctgca
ggcagtggcaagagtacttgttggaggagcttatttaagattcagaatcggctggcagcc
atggaacacacctcaaccaagggtttccaatctgtggaaattgtccacctataccctagt
gtgctcaactccaaagaatacctagggtggtcagaaggtccctcctggcactatggcatc
tttcctaagctccttcatgctgccccttattgtaagagtgtgggctcagaagagccgtca
gagaaattcacagggatccagcaatggataatatgtgatggggcccctaatcatgcatgg
acagactctgtcacttgccttctgagggaccctcctcagctgagtctcccaaatgggcaa
cagatagcacgacccctaggtacttttttcttgatagaggtggcagaggcagcaggcatg
tctcctactgtgttaggccggtgtgctcttgtctggtgtagtggggaacagacttggcat
tccatgcttagtgtcttgatggcatctctgccacatgaataccacctacagcaagagaca
atcactgagttcaactacttagctgaagtgctggtgccttcagtgctccgattccttacc
cgcataggtgccagttctcagctacaggtacatgggcatcaagctgtttgcccgggtgtg
gcagaagtcaccagcctggtccgtatcttgcgtgctctacttgacccccttctacactta
ttcgaggaagagaagtcatacaccaaagaggactttagtggcagtgatcttgtgacccaa
aacttcaaatcttcaaaaaccagggtccagtctgaccgtgtcaatgtgaataaaaagcag
agaagacatttgctggctatcagcagctttctttttgccataatctggagttttggagcc
caccttccctccagacactggcctctctttgatgacttcatgaagaagtctattagttcc
ctgcccaactaccctgagccacctccttcagccttggtgtttgatctacatgtaaacttt
gaagatgggacactggtccccttcactggccagtatctgagcacccatgtcaaaggaaat
ctgggttctttccagccctcttctcagactgaacagcttttgtatgtggtggacctgctt
ctgtcaaatggacagccagtgctgcttgctggagagatagcaacgggaaagtcagctttt
gtggaggtgctggtgaagccaaattaccctgtcattcacagtcccattcaccctgcctta
aattctactcaccttcgtcacctgctgagcagaggagtccatggccaaacacaagccagt
tcaattcctgggcatcaccaggactccaaaggctccatcctttttctgatggaagatctg
cacctggctacttttgatccagagaagaactgccagccagtgctggagactctgcggcag
gcaatggaaggcaccatctatgcccacaacaccttggaattacagactctgcagactaca
gtcaacttccttgccactgctacagtgccaggctactctgagcgcccgctctgtccacgt
ctctaccgactcttcacagtgctggccctgaacagcatgactcaggacaccctgttgagc
aggcatgtccctagtattcaagcctggcttgagcgcttcccttctgtggagcgggagcac
actctggcaagagcccttgtcagggcttcagtggaggcgtgggaggctgtgtgcaagtgt
ttcatgccttcacccctccgcccacactaccgcttctccccacattctgtgagccacatt
ttgggaagcctgcagctgctgcctaccagaatgggttcacgaggttttgcagagactttc
catcaccaggagtatctgcgacgggtatccggcttgcgtggaactcgcctgactatcatg
atgtctatgcgtgtcatggtgcgtctttggttgcatgaggcacaaagaacattttgtgac
cggctggacagcgatagggaacgttcccattgtgctaagctgcttctagaagtagctcag
aatgtcttctgtggtgggccagggtctgagtccttggccaaggactgtgaggaagaggag
gtggaggaggagaaagtgcctgaagtagaatctgaagaagaaatagcccagtgggagacc
ttaagcaacagtgacagtggatcagaggaagaggaggatccatatggccttcaggccacc
acaggctcattcctcagtgagaacagtctagcaccattccccagaaagtcagtaaacaag
gagaacacagaaaatgtaagtcagatggccgagcaggaggaagatataagggattctagc
agtaagctccagtccaagacacccaagcatgagtggcagatggcaccccagatggactta
agtttacctttgttgctaccggtgctattgttctatccccaggagagtccctcagacctg
gtgttcagtctggagcttacactgggatctaactttgagagtcccaacttgtacctggaa
cggcagtgggaaaaccttgaaaagcagttggttgccacagctgttcggctgaagatgaac
tctggtttttcccagtgccctgtgatggtccagcatgtagctcacctggtcagagtcctg
gctaggccccagcagcatgctctattgctctcagaattccggggtactgggcgctataca
gccatcatcctggcttctagcatttgtcaggctcaccttcattatttatcggtcgaatca
gaggaagctattttccaatgtctccgagatgccagctggcatgctggcctgttaaaccag
ccagtggctcttttggtgcctgaaggagtgaatgttgctatcttttgccgactattggcc
ctggcaacctcaggtagcttccctgaccagtacacagaagcagatctggataacatcgaa
gagcacttccccaaggagaacattgcgaacaaacatgccattaagagggacacaatactg
aataggttttaccagcaagtgtgtaacaacctccacatgttcttcatggtgggagataac
caagcccaaaatcagctggcccctacccttttcctgaatctccttcaattgaccattgcc
agtgttgaacgctatgaaccctgggaccaagcttctctggtcaggattgctcaattctgc
ctggagaatgatcacagtctacctcttgatgatggttccttgaagtacccagatttcaag
cacttaattcctaatgtggccaacatcatggctcgcatccatgtttcatctgcctgttac
cataaacacatgtgccctgcattgccacttgtcacccccaagaccttccaggacttcttg
gatatgttcctgcagcaacagcagcagatggtcctgcagatgaggatgagggccagtcgc
attcagactgccttgaagactctgaggctgatggttgagaggcacagtacccaaaccagc
ctgctcactgacttggaagcacagctaaaaggctcctacaaaagtgttggtatatgtcaa
ggccaactcgagcaatccaagatcatgtacaggcagaagatgatagaatgccaacatcag
gagagcctcattgagaatctggtcaggcagcatgatgccctaaaggctcaacaggaggtt
ttcctggagcagatgggcaaggcatttgtaggtcctttgagccagctgcgggtggctgac
tttgaggagataagaagctatcgagccccaccagagtctgtagtcaaggtgacagatgca
ttgtgtgacctgttccaccaagagacaggctggtccagtgccaagcagctgttatgtact
gaagacttttatcaggagctggtattcttccccaaagagaagctgacggactcagagttg
gtcaagttaaacgaagctctaagggctccaggtatgagtgatgcagccttgaggtcagta
agcattcctgcagcaaacctggcagtctggctctgggcggtcctgcgctatgggttggca
caacgccgaggattgcccactggcctgctgctgcggcaggtagatgcaacactggctcgg
gagcaggcacgccttggccagttccagtttcaggcccatgatctgctagagcaaactcgg
tctttgactaaaaagctagaagatgcccaagtcagccataaccatgtaatggagaccctc
aatcaggcacaatgtggaaactttcagaaatggcccatggagtccgcactgctcacgccc
atgcacatgtggacaacacagctccagaagttgcaggagcaagccaagactgtgtttgga
gatgcactcttgtgctcagctgccatcatctatctgggtcccttcccaccacagaggcgt
caagaactgctagaaaagtggctatctctgtgtcagggctctgaggaagccctagaccca
gatgatgtggcacgggcactgaggcagaaatctgttggggtaccaaagaaccctctgctg
cccacacgtactcccttcagtattttgaccttgctgagctatggatctgaactgcaccag
tgggatcgagacctgaagccccaagcaaagtcagcccgtctgctaggcctgctgctgcga
agccacatccatttcagcagttcccgttggcctttgctaattgaccccagcaaccaggcc
atcatgtggttgaatccactacctccaaaacagaacaggtcgttggaaccatctcccaaa
gagagcaaagaaaagttccatgtgacaaaacaagacagtggggataatacagaagatgaa
ctggaagatgagaacaatgaagaggaagatgaggccaatgagcaaagaaaagagcagaaa
gcagaggaaaacaagattcagggagagaacgagcaggaagtacaagaaacagaaaaagag
aatgagccagagagctcaggctcacactcaagtctcccttctgagactcagtctctgccc
tcctgcctcactgtgctctcaggcactgacccagagttgggtccccagctcctggaggca
gctgccaatggcttgcctgtgctcttgaccaatgtggagctgagcctagggtgccaagaa
cttcaatggctgttgtcaaagaagaatctgagtccaccctccgtgcagcctggcttctgt
ctctttctgagcactacctttcccatccatgctttgagccgagtactaggttttgaaatg
ctgaaagggttgaatgttctggatctgggtctgaacatggaaatactagaagaacaaatg
ctgcatgaaatcctgtgcagagagcgccctgagcttgaaacccgctggcaagatctcaaa
atcagagcagcagatacctatgaagctatgaaggctgatgaggaacagttgctggtgaca
ttgctacgtcagaaccaaaagcgtcagaaaccatccaagtttttgagaaaaatggtgagg
actcaggcaaagatatgtcaactgaatgctcaaatggaagagctagaagaccagaagcag
gaggtggtggcattgtgggcaccctaccggcccgtagcttatcatggaatggctatggta
gaagctctaagccctctacagaaccttctgccatctttctgtatgacgtcagagaattgg
ttggcagtcatcaggcgggctatagacagtatgaagtcatatgacagttatcgtggagaa
gacttgcccagccatctgcttcggttgaaaatacacctggcccgccagctgctgaccaac
actgtggttgccctaggcttgatccaaacacccttggtgggtgccttcggtgctttggcc
atgctgcaagtgacaacgaagacaccaaagctagagagattggcattatggcctggactg
tcagcctctcccagctcaggtcacaacatgcagatccctggtgtgattaggccagcctgg
ctaagttcaaaagcctgggaagaatgtggagcattggaactgttgcccccatttgcaggg
ctgtgtgaatccctggcaggtcactctggtgtgtggcaggattacctgtcactatcatcc
actgtgctaggtcctgcacctggtcctaattctgagccacttagcctcttccagaagctg
attctgtggcgggtactgcgaccagattgcctggcaggtgccctagcagacctcaccacc
agcctattaggtcggccactagatgaaaacctgggtgctcctaccatgatctttgaacat
attcagcctactcagcccatactgatcttgctgccaccacctggccaccctacagccacc
ctgcatcctgtgactgttatccggaaactggctgccaatcacgaaaagcctcagcatcta
catgtgatagcactgggctcggaagactgggatcctgtatcaactgtagtcaacactcta
tgccaggctatgctccaggggcactggctagtgctagataactgtcatttgatgcccttt
tggccaagagagctcttacagccattgcagggactgctggatagagccagggtggtctca
gactctgaactgctagctgaaccagagagcaggagtgtggtcaccgtccatagagatttc
cgtctttggctgattgtgcctaccgaggccagtacttccttgccagggatgctgacccag
agctccatgcctgttttctggaatcagtccttagaactgggccggatcttgatcgacagt
ttggattcccagcaaggactctgcacacaacctctcacccagacactgcctttattcttc
ttgcatggtctcctacttcacagacagctctatgggttaaagctgcaagcacacaggggg
cgctggagtcaagtgaccttgaccagggctcttcagatccaagagcagctgtgggctagt
ctcgggaaccccagtgctgccttgctggagctgactgcttcagttctctacggaggttct
ttgggggacctagaggacagagaggccctggttagcctgacaagaacctgcctaaatccc
agaaacatgaactgggaccagccacatactccccaatatctcctggccactctgatgccc
agcccagagctaggggaactggatgccaggacagattgcaaggcccagatgcacctactg
cccacaccacctgaacctcgtacctgtggactaaacgaagcgccccaggcctggctgatg
agacgccaaagtcgtgttctcctgaatgcgctgcagaagtgttcatccacgtgggttcct
acagtttgtggaggaattgcccagcgcaaagaaaggcaacttcagcaacgcctggcacaa
gccaagaagaggctggtggcacttcaggctttgctaaccaacaaccgtattcgctcaggc
cagtgtgtcaccccctgggcagtgttaggacccaatgcccggcgacctctagagggtttc
ttagagaccgaggtgctggaactgaagcacctggtgggtacactgctgtgtgaccttgac
tgcctattgcagcagctgaagggcgggaccccatgcacttccagtcgctgcgctaaggta
gcccaggctctttgggctggacacctacctcagccttggagatctcatgctcttgctggt
tcacagcttccctggctatggctgcggcaactgtcccgccgtgggcacctgttgattcgc
tacctggacagtggcatgagcgaaaatgccaacaaaccagagcgcatatttcacctgtcg
gctttccgccaccctggtcgcctgttgctggcattgcgttgggaggctgtcctggagaac
tcggtgcacaaccccaaccttcctggtcaccaagactctatctctggcagtctcccacct
aaatggcaggagttgagcaatcaccctctgcatatttgggtggagaatggtccaaatccc
aaagttcctaagatgggactgctgctgactgggttacaactccagcatgccgagtgggac
cagacagatggagccttgcaggacagtttttccagccaaccctgccccctgcctcctgtc
agcatcagcacacaagcccggcgtggcaaagatgcacctgtctcagctggtctgggcatg
tactcctgtcctgtatacatgactgggccctttggcaccactaagctgcatagcaagaac
atcctgatgcacctgccactccccacaaggctcagccctgacacatgtattcaacggaga
gtacatgtgtgcagcccaactttaacctga

DBGET integrated database retrieval system