KEGG   Mus musculus (house mouse): 77574
Entry
77574             CDS       T01002                                 
Symbol
Tcaf1, 2810407D09Rik, 3321401G04Rik, A230020K05Rik, Fam115a
Name
(RefSeq) TRPM8 channel-associated factor 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Peptidase_M60 M60-like_N
Other DBs
NCBI-GeneID: 77574
NCBI-ProteinID: NP_084206
MGI: 1914665
Ensembl: ENSMUSG00000036667
UniProt: Q8BNE1
Position
6:complement(42644933..42687065)
AA seq 922 aa
MATPSAAFEALMNGVTSWDIPEDSVPCELLLIGEASFPIMVNDVGQVLVAASSYGRGRMV
VASHEDFLLESQLFVFLVNAVGWLRSSPNSAIGVHSSLAPLVKILESCGIESKIEPEVND
SLGVYCIDAYNETMTDKLVQFVKRGGGLLIGGEAWDWDTQGDDDRVLFAFPGNLVTSVAG
VYFTDNKADTSFFKVSKKMPKIPILVRCDDDLSDDRDELLRGIIDLDITNSDCFPSQLLV
HGSLAFPLGLDTYHGCVIAAARYGRGRVVVTGHKVLFTVGKLGPFLLNAVRWLDGGRKGK
IVVQTELRTLSGLLAVGGIDTSIEPHLTSDASVYCFEPTSDVGVKELQEFVAEGGGLFVG
TQAWWWAFKNPGVSPLARFPGNLLLNAFGISITSQSLNPGPFRTPKIGTRTYHFRSTLAE
FQVIMGRKRGNVEKGWLAKLGPDGATFLQIPAEEIPAYMSVHRLLRKLLSRYRLPVATRE
NPVINDCCRGAMLSLATGLAHSGSDLSLLIPEIEDVYSSRYLRPSASPITVNVNCTNPGT
RYCWMSTGLYIPGRQVIDVSVPESAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLD
KPTKSITCLWGGLLYIIVPQNSKLGSVPLTVKGAVRAPFYKLGETSKEEWKRRLLEYPGP
WGELATDNIILTVPTANLRTLENPEPLLRLWDEMMQAVAKLGGETFPLRLPQRIVADVQI
SVGWMHAGYPIMCHLESVQELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCN
LWCVYVHETVLGIPRSRANIALWPPVREKRVRIYLSKGPSVKHWNAWTALETYLQLQEAF
GWEPFIRLFTEYRNQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPIQKEVA
TSLAYLPEWKENIMKLYLLTQM
NT seq 2769 nt   +upstreamnt  +downstreamnt
atggcaactccctctgctgcctttgaggcccttatgaatggagtaacgagttgggatatc
cccgaggattctgttccatgtgaactgcttcttattggagaggcttcatttcctataatg
gtgaatgacgtgggccaggtcctcgttgccgcctcttcctatggcagaggccgcatggtg
gtagcatctcatgaggacttcttgctggaaagccagctctttgtctttcttgtcaatgct
gttgggtggcttcgttcctcccctaactcagccattggtgtgcactcatctttagcacca
ttggtgaaaattctcgagagctgtggaatagagtcaaagattgagccagaagtcaatgac
tccctgggggtttactgcattgatgcctacaatgaaaccatgacagataagctagtccag
tttgtgaaacgtggagggggcttgctcataggaggcgaagcatgggattgggatacccag
ggtgatgatgatagagttctgttcgcatttcctgggaatctggtgaccagtgtggctggt
gtgtacttcactgacaacaaagcagacacaagtttctttaaagtctccaagaagatgcct
aagatacccatcttagttcgttgtgatgacgacctctcagatgacagagatgagcttctg
cgtggcataatagacctggacatcaccaactcggactgcttcccatcccagctactagtt
catgggtctttggcttttcctttggggctagatacctaccatggctgtgtgatagctgca
gctcgctatggccggggtcgggtagttgtaactggtcataaggttttatttactgtgggt
aaactcggcccctttttgctcaatgctgtccgctggctggatggtggccgcaaaggcaag
attgtggtacagacagagctgagaacactaagtggtctgctcgcagtagggggtatagac
accagcattgagccccacctgaccagtgacgcaagtgtctattgttttgaacccacaagc
gatgtgggggttaaggaactacaggagtttgtagcagagggtggtgggctgtttgttgga
actcaagcctggtggtgggcttttaagaacccaggagtgtcccctctggctcgattccca
ggaaacctgctcctcaatgcctttggtatcagcatcacaagccagagtctcaatccagga
cctttccgtacccctaaaataggaacaaggacctatcacttccgctctaccctagcagag
ttccaggtgataatgggcaggaagagagggaatgtggagaagggctggctagccaagcta
ggcccagatggggcaactttcctgcagattcctgcagaagagatccctgcttacatgtct
gtgcacagactcctgaggaagctgctgagccgctatcggcttccagtggcaaccagagag
aacccggtcatcaatgactgttgtaggggagccatgctttccctggccacaggtctggcc
cactctggaagtgacctctcactgctgatcccagaaattgaagacgtgtacagcagccgc
tacctgcgcccctcagcgtctcccatcaccgtgaatgtcaattgcactaatccaggcact
cgatattgctggatgagcaccggactctacatacctggaaggcaagtcatagatgtctcc
gtgcctgagagtgctgcctctgctgacctgaagatacaaattggctgtcatactgatgat
ctgacaagggccagcaagctgttccgaggcccccttgtgattaaccggtgttgcttggac
aaacccacgaaatcaatcacctgcctctggggtggtctcctctatatcattgtgcctcag
aatagcaaactgggttctgtgccccttacagtgaagggggctgttcgtgctccattctac
aagctaggggagacatccaaggaagaatggaagaggcgtctcctggaatatccaggtcca
tggggagaactggccactgacaacatcatcctgactgtgcccactgcaaatcttcgaacg
ctggagaatcctgagccactgctccgcctctgggatgagatgatgcaggctgtggctaag
ctgggaggcgagaccttccctttgcgtctgccacagaggatagtggctgatgttcagatc
tcagtaggctggatgcacgcagggtaccccatcatgtgccatctggagtcagtgcaggaa
ctcatcaacgagaagctcatccggaccaaggggctctggggccctgtgcatgagctgggc
cgcaatcagcagaggcaggagtgggagttccccccacatactacggaagccacgtgcaac
ctgtggtgtgtttacgtgcatgaaacggtcctgggcataccccgaagccgtgccaatatt
gcgctatggcctccagttcgggagaagagagtccgaatctacttgagcaagggacccagt
gtgaaacactggaacgcctggactgcgttggaaacgtacctacagctccaagaggccttt
ggttgggagccatttattcgtctcttcaccgagtacagaaaccagacaacatcgagctcg
ccgccctcagacaacgtcgacaaaatgaatctatgggtcaagatgttctcccagcaagtg
cagaggaatctggctccattctttgaggcctggggctggcctatccagaaggaagtggct
acaagcttagcctatctgcccgaatggaaagagaatataatgaaattgtacctcctcaca
cagatgtaa

DBGET integrated database retrieval system