KEGG   Mus musculus (mouse): 77579
Entry
77579             CDS       T01002                                 

Symbol
Myh10, 5730504C04Rik, 9330167F11Rik, Fl, Fltn, Myhn, Myhn-, Myhn-2, Myhn2, NM2B, NMHC_II-B, NMHC-, NMHC-B, NMHCII-B, NMMHC_II-b, NMMHC-B, NMMHC-IIB, SMem, SMemb, mKIAA3005
Name
(RefSeq) myosin, heavy polypeptide 10, non-muscle
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04270  Vascular smooth muscle contraction
mmu04530  Tight junction
mmu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    77579 (Myh10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    77579 (Myh10)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    77579 (Myh10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    77579 (Myh10)
   04147 Exosome [BR:mmu04147]
    77579 (Myh10)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     77579 (Myh10)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   77579 (Myh10)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N IQ ADIP CC2-LZ Crescentin AAA_22
Other DBs
NCBI-GeneID: 77579
NCBI-ProteinID: NP_780469
MGI: 1930780
Ensembl: ENSMUSG00000020900
Vega: OTTMUSG00000005955
UniProt: Q61879 Q3UH59
Position
11 B3; 11 41.95 cM
AA seq 1976 aa
MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMV
ELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPGELERQLLQANPILESFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLL
LEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNIS
FKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFA
VEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECW
FPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLN
DNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKES
LTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEE
ERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTK
VKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAET
ELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLD
EEEGARQKLQLEKVTAEAKIKKMEEEVLLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEE
KAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQVDE
LKVQLTKKEEELQGALARGDDETLHKNNALKVARELQAQIAELQEDFESEKASRNKAEKQ
KRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEDETKNHEAQIQDMRQR
HATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQ
VQELHAKVSEGDRLRVELAEKANKLQNELDNVSTLLEEAEKKGIKFAKDAAGLESQLQDT
QELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKV
DDDLGTIESLEEAKKKLLKDVEALSQRLEEKVLAYDKLEKTKNRLQQELDDLTVDLDHQR
QIVSNLEKKQKKFDQLLAEEKGISARYAEERDRAEAEAREKETKALSLARALEEALEAKE
EFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATED
AKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLLKQVRELEAELEDERKQRALAVASKK
KMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEK
KLKSLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIAQ
LEEELEEEQSNMELLNDRFRKTTLQVDTLNTELAAERSAAQKSDNARQQLERQNKELKAK
LQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVED
ERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSRE
VSTLKNRLRRGGPISFSSSRSGRRQLHIEGASLELSDDDTESKTSDVNDTQPPQSE
NT seq 5931 nt   +upstreamnt  +downstreamnt
atggcccagagaactggactggaggatcccgagaggtatctctttgtggacagggctgtc
atctacaaccctgccactcaagctgactggacagctaaaaagctggtgtggattccatcg
gaacgccatggttttgaggcagctagtattaaagaagagcggggcgatgaggttatggtg
gagctggcagagaatgggaagaaagcaatggtcaacaaagatgacattcagaagatgaac
ccaccaaagttctccaaggtggaggatatggcagagctgacatgcttgaacgaagcctct
gtcttacataatttgaaggaccgctactattcaggacttatctatacttactctggactc
ttctgtgtggtgataaatccttacaagaaccttccaatttactctgagaatattattgaa
atgtatagagggaagaaacgccatgagatgccaccacacatctacgccatatcagagtct
gcttacagatgcatgcttcaagatcgtgaggaccagtcaattctatgcacgggtgaatcg
ggtgccgggaagacagaaaataccaagaaagtcattcagtaccttgcccacgttgcttct
tctcacaaaggaagaaaggaccataatattcctggggaacttgaacggcagcttttacaa
gcaaatccaattctggaatcctttggaaatgcgaagactgtgaaaaatgataactcatct
cgctttggcaagtttatccggatcaactttgatgtaactggctatattgttggggccaac
attgaaacataccttctggaaaagtctcgtgctgttcgtcaagctaaagatgagcgtaca
tttcatatcttttatcagttgctctctggagcaggggaacacctgaaatccgacttactc
ctggaaggtttcaacaactacagattcctctccaatggctatattcctattcctggacag
caagacaaggataacttccaggagaccatggaagccatgcacatcatgggcttctctcac
gaagagatcctctcaatgcttaaagtcgtatcttcagtgctgcagtttggaaacatctct
ttcaaaaaggagagaaacactgaccaagcctccatgccggagaacacagtcgcacagaag
ctctgccacctgctcgggatgaatgtgatggagttcactcgggctatcctcacgcccagg
atcaaggttggccgggattacgtacagaaagcccagaccaaagagcaggctgattttgca
gtggaagcattggcaaaagctacctatgagcggttgtttcgctggctcgttcaccgcatc
aataaagcgctggataggaccaaacgccagggagcttccttcattgggatcctggatatt
gctggttttgaaatttttgagctgaactccttcgagcagctgtgcatcaactacaccaac
gagaagctgcagcagctgttcaaccacaccatgttcatcctggagcaggaggagtaccag
cgagagggcatcgagtggaactttatcgacttcggcctggacctgcagccctgcatcgac
ctgatagagagacctgccaatccccctggcgtgctggccctcctggatgaagaatgctgg
ttccccaaagctacagataaaacatttgttgaaaagctggttcaggagcaaggttcccac
tccaagtttcagaagccgcgccaactgaaagacaaagccgacttctgcatcatccactac
gcggggaaggtggactataaggcagatgagtggctgatgaagaacatggacccgctgaat
gacaacgtggccaccctcctgcaccagtcctcggacagatttgtggctgagctttggaag
gacgtggaccgaattgtaggtctggatcaagtcactgggatgactgagaccgcgtttggc
tctgcatacaaaaccaagaagggcatgttccgaaccgtcgggcagctctacaaggagtct
ctcaccaagctgatggcaactctccgcaacaccaaccccaacttcgtccgctgcatcatt
ccaaatcacgagaagcgggctgggaaactggacccgcacctcgtgctcgatcagcttcgc
tgtaacggcgtcctggaagggatccggatctgtcgccaggggttccccaaccggatagtt
ttccaggaattcagacagagatatgagatcctaactcccaatgctattcctaaaggcttc
atggatggcaaacaggcgtgtgagcgaatgatccgagctttagaactggacccaaacctg
tatagaattggacagagcaagatatttttccgagctggagttttggcgcacttagaagaa
gaaagagatttaaaaatcactgatatcatcatctttttccaagctgtatgcagaggctac
ctcgcccgaaaggcctttgccaagaaacagcaacaactaagtgccttaaaggtcttgcag
cggaactgtgcggcgtacctgaagctgcgacactggcagtggtggcgtgtcttcacgaag
gtgaagcctctcctccaagtgacccgccaggaggaagaactccaggcaaaagatgaggag
ctgctgaaggtgaaagagaagcagacaaaagtggaaggggagcttgaggagatggagcgg
aagcaccagcagctgctggaagagaagaatatcctggcagaacaactgcaagccgagacc
gagctcttcgctgaagcagaagagatgagagcaaggcttgctgccaaaaagcaggaactg
gaggagattctccatgacctcgagtccagggtggaggaggaggaagagcggaaccagatc
ctacagaatgagaagaagaagatgcaggcgcacattcaggacctagaagaacaactggat
gaggaggagggggcccggcaaaagctgcagctggagaaggtgacagcagaggctaaaatc
aagaagatggaagaggaggttctgcttctcgaagaccagaattccaaatttatcaaagaa
aagaaactcatggaagaccgaattgctgagtgttcctctcagctggctgaagaggaagaa
aaggcaaaaaacttggccaaaatcaggaataagcaagaagtgatgatctcggacttagaa
gaacgcttgaagaaggaggagaaaactcgacaggaactggaaaaggccaaacggaagctg
gatggggaaacaaccgatctgcaggaccagatcgctgagctgcaggcacaggtcgatgag
ctcaaagtccagttgaccaagaaggaggaggagcttcagggggcgctggccagaggagat
gatgagacactgcacaagaataatgcacttaaagttgcacgggagctgcaggcccaaatc
gcagagctccaggaagactttgagtctgaaaaggcttcaaggaacaaggctgagaaacaa
aaacgggacttgagtgaggagctggaagctctgaagacagagctggaggacaccctagac
accacagcagctcagcaggaactccgcacaaaacgtgagcaggaagtggcagagctgaag
aaggctcttgaggatgaaactaagaaccacgaagctcagatccaggacatgagacagagg
catgccacagcgctggaggagctttccgagcagctggagcaagcgaaaaggttcaaagcc
aacctggagaagaacaaacagggcctggagacagacaacaaggagctggcgtgtgaggtg
aaggtgctgcagcaggtgaaggcggagtcagagcacaagaggaagaagctggatgcccag
gtccaggagctccatgccaaggtgtcagagggtgacaggctcagggtagagctggccgag
aaagcaaacaagctacagaatgagctggataatgtgtcaaccctgctggaagaagctgag
aagaaaggtattaagtttgcgaaggatgcagctggtctcgagtctcaactacaggacaca
caggagctccttcaggaagagacacggcagaaactgaacctgagcagtcggatccggcag
ctggaggaggagaagaacagccttcaggagcagcaggaggaggaggaggaggccaggaag
aacctggagaagcaggtgttggctctgcagtcccagctggctgacaccaagaagaaagtg
gacgatgacctggggacaatcgagagtttggaggaagccaaaaagaaactgctcaaggat
gtggaggcgctgagccagcggctggaggagaaggtcctggcgtatgacaagctggagaag
accaagaaccggctgcaacaagaactggatgacctgacggtggacctggaccaccagcgc
cagatcgtctccaacttggagaagaaacagaagaagttcgaccagctgttggcagaagaa
aagggcatctctgctcgctatgcagaagagcgggaccgggctgaagctgaggccagagag
aaagaaaccaaagcgctctccctggcgcgggcccttgaggaggccttggaggcgaaggag
gaattcgagaggcagaacaagcagcttcgagcagacatggaagacctgatgagctctaaa
gacgatgtggggaagaacgtccacgagcttgagaaatccaagcgagccttggagcagcag
gtggaggagatgcggacccagctggaggagctggaggacgagctgcaggccactgaggat
gccaagctccgcctggaagtcaacatgcaggccatgaaggcccagtttgagagggacctg
caaacccgagatgagcagaatgaagaaaagaagcggctgctgcttaagcaggtgcgggag
ctcgaggcagagctggaggatgagcggaaacagcgggcactggctgtggcgtcaaagaag
aagatggagatagacctgaaggacctggaggctcagatcgaggctgcgaacaaagcccgg
gatgaagtgatcaagcagcttcgcaaacttcaggcacagatgaaggattaccagcgtgaa
ctagaagaggctcgagcatctagagatgagatttttgctcaatccaaagaaagtgaaaag
aaactgaagagtctagaagcagaaattcttcagctgcaagaggagctggcctcatccgag
cgagcccgccgacacgcagagcaggagcgagacgagctggctgatgagatcgccaacagc
gcctctggaaagtctgcgctgttggatgagaagcggcgcctggaagcgcggatcgcacag
ctggaagaggagctggaggaggagcagagcaacatggagctgctcaatgaccgcttccgc
aagaccacgctgcaggtggacacactgaacacagagctggcagcagagcgcagcgctgcc
cagaagagtgacaatgcccgccagcagctggagcgacaaaacaaggagctgaaggccaag
ctgcaggagctggagggggcagtcaagtccaagttcaaggctaccatctcagccctggaa
gccaagattgggcagctggaggagcagcttgagcaggaagccaaggagcgagcagctgcc
aacaaactagtccgtcgaacagagaagaaactgaaagaaatcttcatgcaggttgaagac
gagcgtcggcatgcggatcagtataaggagcagatggagaaggctaatgccaggatgaag
cagcttaaacgacagttggaagaggctgaggaagaggccacacgtgccaacgcatctcgg
cgtaaactccaaagggagctggacgacgccactgaggccaatgaaggcctgagccgcgag
gtcagcactctcaagaaccggctcaggcggggcggtccaatcagcttttcttcaagccga
tctggccggcgccagctgcacattgagggggcatcgctagagctgtcagatgacgacaca
gaaagtaagaccagtgatgtcaatgacacacagccaccccaatcagaatag

DBGET integrated database retrieval system