KEGG   Mus musculus (house mouse): 77590
Entry
77590             CDS       T01002                                 
Symbol
Chst15, 4631426J05Rik, BRAG, GalNAc4S-6ST, GalNAcS-6ST, MAd5, mKIAA0598
Name
(RefSeq) carbohydrate sulfotransferase 15
  KO
K08106  N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase [EC:2.8.2.33]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    77590 (Chst15)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    77590 (Chst15)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    77590 (Chst15)
Enzymes [BR:mmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.33  N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase
     77590 (Chst15)
Glycosyltransferases [BR:mmu01003]
 Unclassified
  Sulfotransferases
   77590 (Chst15)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    77590 (Chst15)
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3
Other DBs
NCBI-GeneID: 77590
NCBI-ProteinID: NP_084211
MGI: 1924840
Ensembl: ENSMUSG00000030930
UniProt: Q91XQ5
Position
7:complement(131837508..131919227)
AA seq 561 aa
MRHCINCCVQLFPEDTHKQQVACQGGPHHSHQACPTCKGENKILFRVDSKQMNLLAVLEV
RTEGNENWGGFLRFRKGKRCSLVFGLIIMTLVMASYILSGAHQELLISSPFHYGGFPSNP
SVMDGENPSDVKEHHYQPSVNNISYVKDYPSIKLIIDSIAARIEFTTRQLPDLQDLKRQE
LHMFSVIPSKFLPTSKSPCWYEEFSGRNTTDPYLTNSYVLYSKRFRSTFDALRKVFWGHL
SHVQGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRL
RDGLRDRYPVEDYLDLFDLAAHQIHQGLQAASAEQPSKMNKIIIGEASASTMWDNNAWTF
FYDNSTDGEPPFLTQDFIHAFQPEAKLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVT
EALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLTVFSKEQFLILRLED
HASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNTRRPEDRSLGPMWPITQKILREFY
GPFNTRLAQVLDDEAFAWKTT
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgaggcattgcattaattgctgcgtccagctgttccccgaagacacacacaaacagcaa
gttgcctgccaaggaggcccccatcacagtcatcaggcgtgccccacttgcaaaggagaa
aacaaaattctgtttcgtgtggacagtaagcagatgaacttgcttgctgttctcgaagtg
aggactgagggcaatgaaaactggggtgggtttttgcgcttcaggaaggggaagcgatgt
agcctggtctttggattgataataatgaccttggtgatggcttcttacatcctttccggg
gctcatcaggaacttctgatttcctcccctttccattatgggggctttcccagcaacccc
agcgtgatggatggtgagaaccccagtgatgtgaaagagcatcactaccagccttctgta
aataacatctcctatgtaaaggactatccgagcattaaactgattatcgacagcattgct
gccaggattgagttcacaaccaggcagctcccggacttacaagatctcaagagacaagag
ttgcatatgttttctgtaatccccagcaaattcctcccgactagcaagagcccttgttgg
tatgaggagttctcgggcaggaacaccactgacccctacctgaccaattcctacgtgctc
tactccaagcggttccgctctacctttgacgctctgcgcaaggttttctggggccacctg
tcccacgtgcagggcaagcacttccgcctgcgctgcctgccccacttctacatcattggg
cagcccaagtgtggaaccactgacctgtacgaccgcctccggctgcatccagaagtgaaa
ttctcagccatcaaggagccgcactggtggacccggaagcgctttggaattgtccgcctg
cgggacggactacgagaccgctaccctgtggaagattacctggacctctttgacttggct
gcacaccagatccatcaaggactgcaggctgcctctgcagagcagcccagcaagatgaat
aagatcattattggagaggccagcgcctctacaatgtgggataacaatgcctggaccttc
ttctatgacaacagcacagacggcgagccaccattcctgacccaagacttcatccatgcc
tttcaaccagaagccaagctcattgttatgctcagggatcctgtggagaggttgtactca
gactatctctacttcgcaagttccaataaatctgcagatgacttccacgagaaagtgacg
gaggctctgcagctgtttgaaaattgcatgctggattattcactgcgcgcctgcgtctac
aacaacaccctgaacaatgccatgcccgtgaggctccaggttggcctgtatgctgtgtac
ctcctggattggctgactgtcttcagtaaggagcagttcctcattctccgtctggaagac
cacgcatccaatgtcaagtataccatgcacaaggtcttccagtttctaaacctggggcct
ctgagtgagaagcaggaagctctgatgaccaagagccctgcatccaacacacggcgtcct
gaggatcgtagtctgggacccatgtggcccatcacccagaagattctgcgtgaattctat
gggcctttcaacacaaggctggcacaggtcttggatgacgaagcatttgcctggaagaca
acgtga

DBGET integrated database retrieval system