KEGG   Mus musculus (mouse): 77609
Entry
77609             CDS       T01002                                 

Symbol
Odad3, AI644415, C330001K17Rik, Ccdc151, b2b1885Clo
Name
(RefSeq) outer dynein arm docking complex subunit 3
  KO
K23733  coiled-coil domain-containing protein 151
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    77609 (Odad3)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  Others
   77609 (Odad3)
SSDB
Other DBs
NCBI-GeneID: 77609
NCBI-ProteinID: NP_084215
MGI: 1924859
Ensembl: ENSMUSG00000039632
Vega: OTTMUSG00000062325
UniProt: Q8BSN3
Position
9:complement(21901167..21914268)
AA seq 593 aa
MTSPLCWAAATTTVTSPEQAPAPSSKAKGSKVHRSKSMGRAQAWPAHHPKSATSFHAMKS
SVHAQVLELQRKIQLLEGDRKAFYESSQWNMKKNQDTINQLQEETKALHVQLKDLLQGDS
KVIQAIIQEWKSEKPFLKNRTCEQALEHLEHQLREKMNQLNALRHQVILRQKRLEDLRLQ
HSLRQLEMAEVQDSNMEAAKTMRNLENRLEKARMKAEEAEHITNVYLQLKSYLQEESLNL
ESRLDSMEAEVMNTKHEVQELKVVNQEAINARDIAKNQLQYLEESAIRDRKKREHYITDC
KKRAEEKKLQTERMERKTHRDHVLLQSEDTIQDHQRHREEELRQRWSMYQMEVMFGKVKD
ATGVAESHAVVRRFLAQDETFTQLENLKKDNELALAKLKEEKQRLQRELENLKYSGDATL
VSQRRLHEEMQKTFKKEEQRHNDVHERLEHTSRILQLVKDCLEHLANKLSHVKLDDTVLA
GKKLDRDSEDYAYNLLVVVQEKLLKLQDQLESQDVPELLRHIADREFLATLEGKLPLYNT
RILLPVASVKDKFFDEEESEDDDRDVVTRAAFKLRSQKLIEARSKKRNRLRRS
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgacgtcccccctgtgctgggcagccgcgaccaccacggtgactagcccggagcaagct
ccagcgccctcttccaaagccaaaggcagtaaggttcaccgaagcaagtctatgggccgg
gcacaggcctggcctgcacatcatcccaagtcagcaacctccttccatgcaatgaagtct
tctgtgcacgcacaggtgcttgagttacaaagaaaaatccaactgttagagggtgaccgg
aaggccttttatgagagctcccaatggaacatgaagaagaaccaagacaccatcaaccag
cttcaggaggagaccaaggctctccacgtgcagctcaaagacctgctgcagggagactcg
aaagtgattcaagcaatcattcaggaatggaagtcagagaaaccgttcttgaagaacagg
acttgtgagcaggccctggagcacctggagcaccagttgagggagaagatgaaccagctg
aatgccttgcgacaccaggtaatactgcggcagaaacggctggaggacctgaggctgcag
cacagcctgcgccagctggagatggcagaggtccaagacagcaacatggaggctgccaag
accatgcgcaacctggagaatcggctggagaaggcccggatgaaggcagaggaggcagag
cacatcactaatgtgtacctgcagctcaagtcttacctccaggaggagagtctcaacttg
gagagccggctagattccatggaggctgaggtgatgaacaccaaacatgaggttcaagag
ctgaaagtagtgaatcaagaggctataaatgcccgggacattgccaagaaccagctgcag
tatctggaggagtctgcgatcagagatcgcaagaagcgcgagcattacataactgactgc
aagaagcgggcagaagagaagaaacttcagacagagcgtatggagcgcaagacccaccga
gaccacgtattgctgcagtcagaagatacaatacaggaccaccagcgccacagggaggag
gagctgaggcagcgctggagcatgtaccagatggaagtgatgtttggcaaggtcaaggat
gccactggagtagctgaatcgcatgcggtagtgcgcaggttcctggcccaggatgagacc
ttcacacagttggagaatctcaagaaggacaatgaactggcgttggcgaagttgaaggag
gagaagcagcggctccagagggagctggagaacctcaagtactcgggggatgctacgctg
gtgagccagcggaggctccacgaagagatgcaaaagacattcaagaaggaggagcagcgt
cacaatgatgtccacgagagactggagcacacctcgcgaatcctccagttggtcaaagat
tgcttggagcatttggccaacaaactgagtcacgtaaaactggatgatacggtattggca
ggaaagaagttagaccgggactcagaggactacgcttacaatctgctggtagttgtccag
gaaaagctgctgaaactgcaggaccaactggagagccaggacgtgcctgagttgctgcga
cacatagcagaccgagagttcctggccacgctagaaggaaagctgcccctatacaacacc
cgcatccttctgcccgtcgccagtgtcaaggacaagttctttgatgaagaggagagtgag
gatgatgaccgtgatgtggtgacccgcgctgccttcaagctccgttcccagaagttaatc
gaagcccgcagcaagaagcgcaataggttgcgcagatcttag

DBGET integrated database retrieval system