KEGG   Mus musculus (mouse): 77622Help
Entry
77622             CDS       T01002                                 

Gene name
Apex2, C430040P13Rik, ape2
Definition
(RefSeq) apurinic/apyrimidinic endonuclease 2
  KO
K10772  AP endonuclease 2 [EC:4.2.99.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
Module
mmu_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    77622 (Apex2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    77622 (Apex2)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     77622 (Apex2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     77622 (Apex2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos zf-GRF Exo_endo_phos_2
Motif
Other DBs
NCBI-GeneID: 77622
NCBI-ProteinID: NP_084219
MGI: 1924872
Ensembl: ENSMUSG00000025269
Vega: OTTMUSG00000019152
UniProt: Q68G58 A2AFM3
Position
X; X F3
AA seq 516 aa AA seqDB search
MLRVVSWNINGIRSPLQGLACQEPSSCPTALRRVLDELDADIVCLQETKVTRDVLTEPLA
IVEGYNSYFSFSRSRSGYSGVATFCKDSATPVAAEEGLSGVFATLNGDIGCYGNMDEFTQ
EELRVLDSEGRALLTQHKIRTLEGKEKTLTLINVYCPHADPGKPERLTFKMRFYRLLQMR
AEALLAAGSHVIILGDLNTAHRPIDHCDASSLECFEEDPGRKWMDGLLSNPGDEAGPHIG
LFMDSYRYLHPKQQRAFTCWSVVSGARHLNYGSRLDYVLGDRALVIDTFQASFLLPEVMG
SDHCPVGAVLNVSCVPAKQCPALCTRFLPEFAGTQLKILRFLVPLEQEPVREQQVLQPSH
QIQAQRQPRKAFMHSTRLRKSQGGPKRKQKNLMSYFQPSSSLSQTSGVELPTLPLVGPLT
TPKTAEEVATATMLEEKNKVPESKDEKGERTAFWKSMLSGPSPMPLCGGHREPCVMRTVK
KTGPNFGRQFYMCARPRGPPSDPSSRCNFFLWSRPS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgtggtaagctggaacatcaatgggatccggagtcccctgcaaggccttgca
tgccaggaacccagcagctgtcccacggccttgcgacgcgttttggacgagctggatgct
gatattgtctgtctccaggagaccaaagtgaccagagatgtactgacagagcccctggct
attgttgagggttataactcctatttcagcttcagccgcagccgtagtggctattctggt
gtggctaccttctgtaaggacagtgctaccccagtagctgctgaagaaggcctgagtggt
gtgtttgccaccctgaatggagatattggttgctatggaaacatggatgagttcacgcaa
gaggaactccgggttctggatagtgagggccgggccctccttacacagcacaagatccgc
acattggaagggaaggagaagactttgaccctgatcaatgtgtactgccctcacgcggat
cctgggaagcctgagcggctgaccttcaagatgcgcttctatcgcctgctccagatgcga
gcagaagcgctcctggcagctggcagtcacgtgataatcctgggggacctgaatacagcc
caccgacccattgaccactgcgatgcaagtagtctggaatgctttgaagaggacccaggg
cgtaagtggatggatggcttgctcagtaacccaggggatgaggctggaccccacataggg
ctcttcatggatagctaccgctacttgcatccaaaacagcagagggctttcacctgctgg
tcagtggtcagtggtgcacgccatctcaactatggctctagacttgactatgtactggga
gatagggccttggtcatagataccttccaggcctccttcttactccctgaagtgatgggc
tctgaccactgccctgtgggagctgtcttaaatgtatcctgtgtgccagcaaaacagtgc
ccagctctgtgtacccgcttcctccccgagtttgcaggtacccagctcaagattcttcgc
ttcctagttcctcttgagcaagaacctgtgcgggaacagcaagtcctgcagcccagccat
caaatccaggcacagagacagccaagaaaagccttcatgcattcaaccaggcttcggaaa
agtcaaggtggccccaaaagaaaacagaaaaacctgatgagttacttccagccttcctcc
agcctttcccaaacttctggtgtggagctgcctaccctgcctctggtgggccctcttaca
accccaaagactgcagaagaggtggcaacagccacaatgctagaagagaagaacaaggtt
ccagagtccaaagatgagaagggagaaaggactgccttctggaagtctatgctgagtggg
ccctcacccatgcccctctgtggaggccacagggagccatgtgtgatgcgtactgtgaaa
aaaacaggacccaactttggtcgccagttctacatgtgtgctagaccccgaggtcctccc
agtgacccctcttcccgctgtaacttcttcctctggagcaggcccagctga

DBGET integrated database retrieval system