KEGG   Mus musculus (house mouse): 77644
Entry
77644             CDS       T01002                                 
Symbol
Steep1, C330007P06Rik, STEEP
Name
(RefSeq) STING1 ER exit protein 1
  KO
K24996  STING ER exit protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    77644 (Steep1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    77644 (Steep1)
SSDB
Motif
Pfam: GFA
Other DBs
NCBI-GeneID: 77644
NCBI-ProteinID: NP_084227
MGI: 1924894
Ensembl: ENSMUSG00000006423
UniProt: Q8VDP2
Position
X:complement(36087388..36127956)
AA seq 222 aa
MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVID
AAKHAHKFCNTEDEETTYLRRPEGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVV
KFGQGFGKTNIYTQKQEPPKKVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAREVADSYAQ
NAKVIEKQLERKGMSKRRLQELAELEAKKAKMKGTLIDNQFK
NT seq 669 nt   +upstreamnt  +downstreamnt
atgccgaaagtcgtgtcgcggtcggtggtctgctcagacacccgggaccgcgaggaatat
gatgatggcgagaagcccctccatgtctactactgtttatgtggccagatggtcctggtg
ctggattgccagttagagaaattgcccatgaggccccgggaccggtctcgcgtgatcgat
gctgccaaacatgctcacaagttttgtaacacagaagatgaggagactacttatcttcgg
aggcctgagggcattgaacgtcagtacaggaagaagtgtgcaaagtgtggactgccgctc
ttctaccaatcccagccgaagaatgctcctgtgaccttcattgtggatggagcagtagtg
aaatttggccaaggctttgggaaaaccaatatatatactcagaaacaagagcctcctaag
aaggttatgatgaccaaaaggactaaagacatgggcaagttcagctctgttactgtgtct
accattgatgaagaagaagaggagatagaggctagggaagttgctgactcttacgcgcag
aatgccaaagtgattgaaaagcagctggagcgcaaaggcatgagcaagaggaggctgcag
gagttggctgaattggaagccaagaaagcaaaaatgaaggggaccctgatcgacaatcag
ttcaaataa

DBGET integrated database retrieval system