KEGG   Mus musculus (mouse): 77706
Entry
77706             CDS       T01002                                 

Gene name
Abcb5, 9230106F14Rik
Definition
(RefSeq) ATP-binding cassette, sub-family B (MDR/TAP), member 5
  KO
K05660  ATP-binding cassette, subfamily B (MDR/TAP), member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    77706 (Abcb5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    77706 (Abcb5)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    77706 (Abcb5)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 RsgA_GTPase AAA AAA_29 Zeta_toxin AAA_33 ABC_ATPase Rad17 G-alpha AAA_7 AAA_5 AAA_30 AAA_15 AAA_28 AAA_18 DUF87 AAA_21 AAA_25 AAA_10 P-loop_TraG DUF3703 Peptidase_M24
Other DBs
NCBI-GeneID: 77706
NCBI-ProteinID: NP_084237
MGI: 1924956
Ensembl: ENSMUSG00000072791
Vega: OTTMUSG00000036992
UniProt: B5X0E4 Q3UT27 Q9CTU3
Position
12; 12 F2
AA seq 1255 aa
MANSERTNGLQETNQRYGPLQEQVPKVGNQAVGPIEIFRFADNLDIVLMTLGILASMING
ATVPLMSLVLGEISDHLINGCLVQTNRTKYQNCSQTQEKLNEDIIVLTLYYIGIGAAALI
FGYVQISFWVITAARQTTRIRKQFFHSILAQDISWFDGSDICELNTRMTGDINKLCDGIG
DKIPLMFQNISGFSIGLVISLIKSWKLSLVVLSTSPLIMASSALCSRMIISLTSKELDAY
SKAGAVAEEALSSIQTVTAFGAQEKEIQRYTQHLKDAKDAGIKRATASKLSLGAVYFFMN
GAYGLAFWYGTSLIFGGEPGYTIGTILAVFFSVIHSSYCIGSVAPHLETFTVARGAAFNI
FQVIDKKPNIDNFSTAGFVPECIEGNIEFKNVSFSYPSRPSAKVLKGLNLKIKAGETVAL
VGPSGSGKSTTVQLLQRLYDPEDGCITVDENDIRAQNVRHYREQIGVVRQEPVLFGTTIG
NNIKFGREGVGEKEMEQAAREANAYDFIMAFPKKFNTLVGEKGAQMSGGQKQRIAIARAL
VRNPKILILDEATSALDTESESLVQTALEKASKGRTTIVVAHRLSTIRGADLIVTMKDGM
VVEKGTHAELMAKQGLYYSLAMAQDIKKVDEQMESRTCSTAGNASYGSLCDVNSAKAPCT
DQLEEAVHHQKTSLPEVSLLKIFKLSKSEWPFVVLGTLASALNGSVHPVFSIIFGKLVTM
FEDKNKATLKQDAELYSMMLVVLGIVALVTYLMQGLFYGRAEENLAMRLRHSAFKAMLYQ
DMAWYDDKENNTGALTTTLAVDVAQIQGAATSRLGIVTQDVSNMSLSILISFIYGWEMTL
LILSFAPVLAVTGMIQTAAMAGFANRDKQALKRAGKIATEAVENIRTVVSLTRERAFEQM
YEETLQTQHRNALKRAHITGCCYAVSHAFVHFAHAAGFRFGAYLIQAGRMMPEGMFIVFT
AIAYGAMAIGETLVWAPEYSKAKAGASHLFALLKNKPTINSCSQSGEKPDTCEGNLEFRE
VSFVYPCRPEVPVLQNMSLSIEKGKTVAFVGSSGCGKSTCVQLLQRFYDPMKGQVLLDGV
DVKELNVQWLRSQTAIVSQEPVLFNCSIAENIAYGDNSRMVPLEEIKEVADAANIHSFIE
GLPRKYNTLVGLRGVQLSGGQKQRLAIARALLRKPKILLLDEATSALDNESEKVVQQALD
KARRGKTCLVVAHRLSTIQNADMIVVLQNGSIKEQGTHQELLRNGDTYFKLVAAH
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggcaaattctgaaagaaccaacgggttgcaagaaactaatcagagatatggacctctg
caagaacaagtgcctaaagtgggaaatcaagctgttggacctattgagatattccgcttt
gctgataatctggacattgtcctcatgactctgggaatattagcatccatgataaatgga
gccaccgttcctttaatgtccctggttttaggagaaataagtgatcatttaattaatgga
tgcctagtacaaactaacagaactaaatatcagaactgttctcagactcaagaaaagctg
aatgaagatatcattgtgttgactctatattatattggaataggagcagctgccctcatt
tttggctatgtacagatttccttctgggtcataactgcagcccggcaaaccacaagaatc
cgaaaacagttttttcattcaattttggcacaagacatcagctggtttgatggcagtgac
atctgtgaacttaacacccgcatgactggtgacatcaacaaactctgtgatggtattgga
gataagatccctctgatgtttcagaacatatctgggttttctattggcctggtgataagt
ttgataaaaagctggaaactctccctggtggttctgtctacatctcctctcataatggct
tcatcggcactgtgctctaggatgattatctcattgaccagcaaggagctggatgcctat
tccaaagctggggctgtggctgaagaagccttgtcatcaatccaaacagtcacagccttt
ggagcccaagagaaagaaattcaaaggtatacacagcacttaaaggacgcaaaggacgct
ggcataaagagggctacggcttcaaagctgtctcttggagcagtctacttctttatgaat
ggagcctatggactggctttttggtatggaacctccttgatttttggcggagagcctggt
tacaccatcggaactattcttgctgttttcttcagtgtgatccatagtagttactgcatt
ggatctgtagcccctcacctggaaaccttcacagtagccagaggagctgcctttaatatt
ttccaggttattgataagaaacccaatatagataacttttcaacagctggatttgtacct
gaatgtatagaaggaaacatagaatttaaaaatgtttctttcagctatccatcaagacct
tctgccaaggttctgaaaggtctcaatctgaagattaaggctggagagacagtagccttg
gttggtcccagtggcagtggcaagagtacgacagtgcagcttctgcagaggctgtatgac
ccagaggacggctgtatcaccgtagatgagaatgacatccgagcccaaaacgtgcgacat
taccgagagcaaattggagtggtcagacaagagccagttctgtttgggaccaccatcggt
aacaatattaagtttgggcgcgaaggtgtgggtgaaaaggaaatggaacaggcagcgagg
gaggcaaacgcctacgacttcataatggcctttcctaagaaatttaatacactagtaggg
gaaaaaggagctcaaatgagtggaggccagaaacagaggattgccattgctcgagcgcta
gttcgaaaccccaaaattctgatcttagatgaggctacatctgccctggacacagagagt
gaatcacttgttcaaactgcactggagaaggcaagcaaaggccggactacaattgtggta
gcacacaggctctccaccattcgtggggcagacctgattgtgacaatgaaggatggcatg
gtggtggagaaagggacccatgctgaactaatggcaaagcaggggctgtactactccctc
gccatggcacaggatattaaaaaggtcgatgaacaaatggaatcaaggacatgttccact
gcaggaaatgccagctatggttctctgtgcgatgtgaatagtgccaaggccccctgcact
gaccagctggaggaagccgtacaccatcaaaagacaagtcttcctgaagtttcactatta
aaaatatttaaattaagcaagtctgaatggccttttgtggttctgggaacactggcttct
gctttaaatggatctgttcatccagtattttccatcatctttggaaaattagtcactatg
tttgaagataaaaataaagctacattaaagcaggatgcagagctctactccatgatgtta
gtcgtcttgggcatagtagctcttgtcacctacttgatgcagggattgttttatggcaga
gcagaggaaaatttagccatgagattaagacactcggcattcaaagccatgctctaccag
gatatggcctggtatgatgataaagagaacaacactggagccctgaccacaacgttagct
gtggatgtagcacagattcagggtgcagcaacttcaagacttgggatcgtaacacaagat
gtgagcaacatgagtctgtccattctcatctccttcatatatggatgggagatgacactc
ctgattctcagcttcgcgcctgtacttgcggtgacaggaatgattcaaaccgcagcaatg
gctggctttgccaacagggataagcaggcgctcaagcgtgctggaaagatagcaacagaa
gctgtggagaacatacgtacggtagtgtcattaacaagagagagagcctttgagcaaatg
tatgaggagacacttcagactcaacacagaaacgccttgaagagagcacacatcactgga
tgctgttatgcagtcagccatgcttttgtgcattttgcccatgcagcagggttccgattt
ggagcctatttgattcaagcaggacggatgatgccggaaggcatgttcatagtctttacc
gccattgcatatggggctatggccattggagaaacacttgtatgggctcctgaatattcc
aaagccaaagctggagcttcgcatctgtttgctttgctgaaaaataaaccaactataaac
agctgcagtcaaagtggggaaaaaccagacacctgtgaagggaacttagaatttcgagag
gtctctttcgtctatccttgtcgtccagaagttcctgtccttcagaacatgtccctcagc
attgagaaagggaagactgtagcattcgttgggagcagcggctgtggaaaaagcacatgt
gttcaactgctgcaaagattttatgaccccatgaaaggacaagtgctgcttgacggagtt
gatgtaaaagaattgaacgtgcagtggctgcgttcccagacagccatcgtctcccaagag
cctgtgctgttcaactgtagcatcgctgagaacattgcctatggtgataacagccgcatg
gtgcccttagaggagatcaaagaggtcgcagatgcagccaacattcattctttcattgaa
gggctcccaaggaaatacaacaccctagtgggactaagaggcgtgcagctttctggcggc
cagaaacaaagactggctattgcaagggctcttctccggaagccaaaaattttactgctg
gatgaggccacttcagcccttgataatgagagtgagaaggtggtccaacaggctcttgat
aaagcccggagagggaagacctgcctagtggtggctcacagactctctacaatacagaat
gcagatatgatcgttgttctgcaaaatggaagcatcaaggagcagggaactcatcaggag
ctcctgagaaatggagatacatactttaaattagtagctgcacattag

DBGET integrated database retrieval system