KEGG   Mus musculus (mouse): 77717
Entry
77717             CDS       T01002                                 

Gene name
Smim41, 6030408B16Rik, AI225877
Definition
(RefSeq) small integral membrane protein 41
Organism
mmu  Mus musculus (mouse)
Other DBs
NCBI-GeneID: 77717
NCBI-ProteinID: NP_001356147
MGI: 1924967
Ensembl: ENSMUSG00000075408
Position
15; 15 F1
AA seq 89 aa
MNGSQVGAAAKAAWLSCCNQSGLPLGPPEGPRMVQAVVLGVLSLLVLCGILFLGGGLLLR
AQGLIALLARERHSTPEAEPGACGGDDDS
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaacggctcacaggtgggagctgcagccaaggctgcctggctgagctgctgcaaccag
tccgggctgccactcggacccccagaggggccacgcatggtgcaggcagtcgtgctgggc
gtcctgtcacttttggtgctctgtgggatcctgttcctgggtggtggactcctcctccgc
gctcagggcctgatagccctgctggcccgagaaaggcattcaacccccgaggctgagcct
ggtgcctgtggaggggatgacgactcctag

DBGET integrated database retrieval system